BLASTX nr result
ID: Atractylodes21_contig00022709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022709 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P50433.1|GLYM_SOLTU RecName: Full=Serine hydroxymethyltransfe... 56 3e-06 >sp|P50433.1|GLYM_SOLTU RecName: Full=Serine hydroxymethyltransferase, mitochondrial; Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; AltName: Full=Serine methylase; Flags: Precursor gi|438247|emb|CAA81082.1| glycine hydroxymethyltransferase [Solanum tuberosum] Length = 518 Score = 56.2 bits (134), Expect = 3e-06 Identities = 35/83 (42%), Positives = 39/83 (46%) Frame = -2 Query: 249 ESGYELVSGGTENHLVLINLKNKVNKRRFLSEFYLANKAIETDVYCQFSNA*NHN*FTYL 70 E GYELVSGGT+NHLVL+N+KNK Sbjct: 373 EKGYELVSGGTDNHLVLVNMKNK------------------------------------- 395 Query: 69 FFLGIDGSRPEKMLAVVHIAANK 1 GIDGSR EK+L VHIAANK Sbjct: 396 ---GIDGSRVEKVLEAVHIAANK 415