BLASTX nr result
ID: Atractylodes21_contig00022638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022638 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi... 54 1e-07 emb|CAD56221.1| hypothetical protein [Cicer arietinum] 59 3e-07 >ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi|355501156|gb|AES82359.1| RNA-binding protein [Medicago truncatula] Length = 454 Score = 53.9 bits (128), Expect(2) = 1e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 98 ELLRISCSFYYLVASSAPFLHIMKIQVMADRE 3 E+LRISCSFYYLVASSA F+H +KIQV+A+RE Sbjct: 264 EILRISCSFYYLVASSACFVHNLKIQVLAERE 295 Score = 26.9 bits (58), Expect(2) = 1e-07 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 220 DIELEETEEIAKKRE 176 DIELEETEE +KRE Sbjct: 250 DIELEETEENVRKRE 264 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 110 HQPLELLRISCSFYYLVASSAPFLHIMKIQVMADRE 3 HQ ++LRISCSFYYLVASSA F+HIMKIQV+A+RE Sbjct: 12 HQLWKILRISCSFYYLVASSACFVHIMKIQVLAERE 47