BLASTX nr result
ID: Atractylodes21_contig00022535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022535 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 70 2e-10 ref|XP_003615335.1| E3 ubiquitin-protein ligase HUWE1 [Medicago ... 70 2e-10 ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 69 4e-10 ref|XP_003518270.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 67 2e-09 ref|XP_002864007.1| predicted protein [Arabidopsis lyrata subsp.... 63 3e-08 >ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL2-like [Cucumis sativus] Length = 3666 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 115 GEGPIGPNVKLDSETPPKVKAFIDKVIQCPLQDIAIPL 2 GEG GP++KLDSE PPK+KAFIDKVIQCPL DIAIPL Sbjct: 18 GEGSFGPSIKLDSEPPPKIKAFIDKVIQCPLHDIAIPL 55 >ref|XP_003615335.1| E3 ubiquitin-protein ligase HUWE1 [Medicago truncatula] gi|355516670|gb|AES98293.1| E3 ubiquitin-protein ligase HUWE1 [Medicago truncatula] Length = 3655 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 112 EGPIGPNVKLDSETPPKVKAFIDKVIQCPLQDIAIPL 2 EG IGP++KLDSE PPKVKAFI+KVIQCPLQDIAIPL Sbjct: 19 EGAIGPSIKLDSEPPPKVKAFIEKVIQCPLQDIAIPL 55 >ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Glycine max] Length = 3654 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 112 EGPIGPNVKLDSETPPKVKAFIDKVIQCPLQDIAIPL 2 EG IGP+VKLDS+ PPK+KAFI+KVIQCPLQDIAIPL Sbjct: 19 EGSIGPSVKLDSDPPPKIKAFIEKVIQCPLQDIAIPL 55 >ref|XP_003518270.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like [Glycine max] Length = 3659 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 109 GPIGPNVKLDSETPPKVKAFIDKVIQCPLQDIAIPL 2 G IGP+VK+DSE PPK+KAFI+K+IQCPLQDIAIPL Sbjct: 20 GAIGPSVKVDSEPPPKIKAFIEKIIQCPLQDIAIPL 55 >ref|XP_002864007.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309842|gb|EFH40266.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 3616 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 115 GEGPIGPNVKLDSETPPKVKAFIDKVIQCPLQDIAIPL 2 GEG IGP+++LD+E PP++K+FIDKVIQ PL DIAIPL Sbjct: 19 GEGSIGPSIRLDAEPPPEIKSFIDKVIQSPLSDIAIPL 56