BLASTX nr result
ID: Atractylodes21_contig00022360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022360 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197927.1| ubiquinol-cytochrome c reductase subunit 7 [Ara... 62 6e-08 gb|ADB02891.1| ubiquinol-cytochrome C reductase complex 14 kDa p... 60 1e-07 ref|XP_002872165.1| predicted protein [Arabidopsis lyrata subsp.... 60 2e-07 ref|XP_003557405.1| PREDICTED: cytochrome b-c1 complex subunit 7... 59 4e-07 ref|XP_002459526.1| hypothetical protein SORBIDRAFT_02g006120 [S... 59 4e-07 >ref|NP_197927.1| ubiquinol-cytochrome c reductase subunit 7 [Arabidopsis thaliana] gi|403399498|sp|F4JWS8.1|QCR72_ARATH RecName: Full=Cytochrome b-c1 complex subunit 7-2; AltName: Full=Complex III subunit VII gi|332006061|gb|AED93444.1| ubiquinol-cytochrome c reductase subunit 7 [Arabidopsis thaliana] Length = 122 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 394 FRSYLTDMLALVKRERAEREALGALPLEQRTIP 296 FRSYL DMLALVKRERAEREALGALPL QRTIP Sbjct: 90 FRSYLQDMLALVKRERAEREALGALPLYQRTIP 122 >gb|ADB02891.1| ubiquinol-cytochrome C reductase complex 14 kDa protein [Jatropha curcas] Length = 122 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 394 FRSYLTDMLALVKRERAEREALGALPLEQRTIP 296 FR+YL DMLALVKRERAEREALGALPL QRTIP Sbjct: 90 FRNYLQDMLALVKRERAEREALGALPLYQRTIP 122 >ref|XP_002872165.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318002|gb|EFH48424.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 122 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 394 FRSYLTDMLALVKRERAEREALGALPLEQRTIP 296 FRSYL D+LALVKRERAEREALGALPL QRTIP Sbjct: 90 FRSYLQDILALVKRERAEREALGALPLYQRTIP 122 >ref|XP_003557405.1| PREDICTED: cytochrome b-c1 complex subunit 7-like [Brachypodium distachyon] Length = 123 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 394 FRSYLTDMLALVKRERAEREALGALPLEQRTIP 296 FRSYL DMLALVK+ERAEREALGALPL +RT+P Sbjct: 91 FRSYLADMLALVKKERAEREALGALPLYERTLP 123 >ref|XP_002459526.1| hypothetical protein SORBIDRAFT_02g006120 [Sorghum bicolor] gi|241922903|gb|EER96047.1| hypothetical protein SORBIDRAFT_02g006120 [Sorghum bicolor] Length = 123 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 394 FRSYLTDMLALVKRERAEREALGALPLEQRTIP 296 FRSYL+DMLALVK+E AEREALGALPL QRTIP Sbjct: 91 FRSYLSDMLALVKKESAEREALGALPLYQRTIP 123