BLASTX nr result
ID: Atractylodes21_contig00022069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022069 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525693.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002319188.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 emb|CBI32840.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_002278394.1| PREDICTED: uncharacterized protein LOC100246... 57 1e-06 emb|CAN73373.1| hypothetical protein VITISV_006322 [Vitis vinifera] 57 1e-06 >ref|XP_002525693.1| conserved hypothetical protein [Ricinus communis] gi|223534993|gb|EEF36676.1| conserved hypothetical protein [Ricinus communis] Length = 502 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 2 LSIYTSVLGAGSFLVHYVSGFVNSILVNFGVSREMQNPV 118 LSIY SVLGAG+F++H++S VNSIL+NFG+S EM NPV Sbjct: 230 LSIYGSVLGAGTFILHHISMLVNSILINFGLSEEMHNPV 268 >ref|XP_002319188.1| predicted protein [Populus trichocarpa] gi|222857564|gb|EEE95111.1| predicted protein [Populus trichocarpa] Length = 501 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 2 LSIYTSVLGAGSFLVHYVSGFVNSILVNFGVSREMQNPV 118 LSIY SVLGAG+F++H +S VNSILVNFG+S +M NPV Sbjct: 226 LSIYGSVLGAGTFILHQISTLVNSILVNFGLSEDMHNPV 264 >emb|CBI32840.3| unnamed protein product [Vitis vinifera] Length = 502 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSIYTSVLGAGSFLVHYVSGFVNSILVNFGVSREMQNPV 118 L+IY SVLGAGSFL+H S VN+ILVNFG+S EM NPV Sbjct: 219 LTIYGSVLGAGSFLLHQFSMLVNTILVNFGLSEEMHNPV 257 >ref|XP_002278394.1| PREDICTED: uncharacterized protein LOC100246460 [Vitis vinifera] Length = 537 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSIYTSVLGAGSFLVHYVSGFVNSILVNFGVSREMQNPV 118 L+IY SVLGAGSFL+H S VN+ILVNFG+S EM NPV Sbjct: 254 LTIYGSVLGAGSFLLHQFSMLVNTILVNFGLSEEMHNPV 292 >emb|CAN73373.1| hypothetical protein VITISV_006322 [Vitis vinifera] Length = 317 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSIYTSVLGAGSFLVHYVSGFVNSILVNFGVSREMQNPV 118 L+IY SVLGAGSFL+H S VN+ILVNFG+S EM NPV Sbjct: 34 LTIYGSVLGAGSFLLHQFSMLVNTILVNFGLSEEMHNPV 72