BLASTX nr result
ID: Atractylodes21_contig00022005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00022005 (996 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273339.1| PREDICTED: ethylene-responsive transcription... 58 3e-06 >ref|XP_002273339.1| PREDICTED: ethylene-responsive transcription factor RAP2-7 [Vitis vinifera] gi|297741491|emb|CBI32623.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 58.2 bits (139), Expect = 3e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -2 Query: 410 RPYDKATIKCNWREAITNFEPNMYDGDLSLEANNGGKKQD 291 R YDKA IKCN REA+TNFEP+ Y+G++ A+NGG Q+ Sbjct: 281 RAYDKAAIKCNGREAVTNFEPSTYEGEIIFPADNGGSSQN 320