BLASTX nr result
ID: Atractylodes21_contig00021845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021845 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE46985.1| mitogen-activated protein kinase [Nicotiana taba... 89 3e-18 gb|ADT91692.1| mitogen-activated protein kinase 4 [Nicotiana att... 89 3e-18 gb|AEQ28763.1| mitogen-activated protein kinase 1 [Prunus salicina] 87 2e-17 gb|AAN65180.1| mitogen-activated protein kinase 4 [Petroselinum ... 90 2e-17 ref|XP_002511904.1| big map kinase/bmk, putative [Ricinus commun... 90 2e-17 >dbj|BAE46985.1| mitogen-activated protein kinase [Nicotiana tabacum] Length = 373 Score = 89.4 bits (220), Expect(2) = 3e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 373 YLAPLHDINEEPVCPRPFSFDFEQPSCTEEHIKELIWRESVKF 245 YLAPLHDINEEP+CP+PFSFDFEQPS TEE+IKELIWRESVKF Sbjct: 325 YLAPLHDINEEPICPKPFSFDFEQPSFTEENIKELIWRESVKF 367 Score = 26.9 bits (58), Expect(2) = 3e-18 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 173 ESVKFNPDPAH 141 ESVKFNPDP H Sbjct: 363 ESVKFNPDPTH 373 >gb|ADT91692.1| mitogen-activated protein kinase 4 [Nicotiana attenuata] Length = 373 Score = 89.4 bits (220), Expect(2) = 3e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 373 YLAPLHDINEEPVCPRPFSFDFEQPSCTEEHIKELIWRESVKF 245 YLAPLHDINEEP+CP+PFSFDFEQPS TEE+IKELIWRESVKF Sbjct: 325 YLAPLHDINEEPICPKPFSFDFEQPSFTEENIKELIWRESVKF 367 Score = 26.9 bits (58), Expect(2) = 3e-18 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 173 ESVKFNPDPAH 141 ESVKFNPDP H Sbjct: 363 ESVKFNPDPTH 373 >gb|AEQ28763.1| mitogen-activated protein kinase 1 [Prunus salicina] Length = 373 Score = 87.4 bits (215), Expect(2) = 2e-17 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -3 Query: 373 YLAPLHDINEEPVCPRPFSFDFEQPSCTEEHIKELIWRESVKF 245 YLAPLHDINEEPVCP PF+FDFEQPS TEE+IKELIWRESVKF Sbjct: 325 YLAPLHDINEEPVCPMPFNFDFEQPSFTEENIKELIWRESVKF 367 Score = 26.6 bits (57), Expect(2) = 2e-17 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 173 ESVKFNPDPAH 141 ESVKFNPDP H Sbjct: 363 ESVKFNPDPIH 373 >gb|AAN65180.1| mitogen-activated protein kinase 4 [Petroselinum crispum] Length = 374 Score = 89.7 bits (221), Expect(2) = 2e-17 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -3 Query: 373 YLAPLHDINEEPVCPRPFSFDFEQPSCTEEHIKELIWRESVKF 245 YLA LHDINEEPVCPRPFSFDFEQP+CTEE+IKELIW+ESVKF Sbjct: 326 YLAALHDINEEPVCPRPFSFDFEQPTCTEENIKELIWKESVKF 368 Score = 23.9 bits (50), Expect(2) = 2e-17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 173 ESVKFNPDP 147 ESVKFNPDP Sbjct: 364 ESVKFNPDP 372 >ref|XP_002511904.1| big map kinase/bmk, putative [Ricinus communis] gi|223549084|gb|EEF50573.1| big map kinase/bmk, putative [Ricinus communis] Length = 370 Score = 89.7 bits (221), Expect(2) = 2e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 373 YLAPLHDINEEPVCPRPFSFDFEQPSCTEEHIKELIWRESVKF 245 YLAPLHDINEEPVCPRPF+FDFEQPS TEE+IKELIWRESVKF Sbjct: 324 YLAPLHDINEEPVCPRPFNFDFEQPSFTEENIKELIWRESVKF 366 Score = 23.9 bits (50), Expect(2) = 2e-17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 173 ESVKFNPDP 147 ESVKFNPDP Sbjct: 362 ESVKFNPDP 370