BLASTX nr result
ID: Atractylodes21_contig00021562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021562 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266648.1| PREDICTED: phytoene dehydrogenase, chloropla... 59 4e-08 ref|XP_002300057.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-08 ref|XP_002515342.1| amine oxidase, putative [Ricinus communis] g... 51 2e-07 ref|XP_003524753.1| PREDICTED: phytoene dehydrogenase, chloropla... 58 9e-07 >ref|XP_002266648.1| PREDICTED: phytoene dehydrogenase, chloroplastic/chromoplastic [Vitis vinifera] gi|296081484|emb|CBI20007.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 58.9 bits (141), Expect(2) = 4e-08 Identities = 28/58 (48%), Positives = 43/58 (74%) Frame = -1 Query: 231 SAIPEQLVSKLPSNSIILNTSVASIDKSESESTYTVRLNNGEVLTSDYGMILQLKNPK 58 SAIPEQL SKLP+ S++LN+ V S+D+S S TVRL NG+ + S+ G+++ ++ P+ Sbjct: 239 SAIPEQLASKLPTGSVLLNSKVVSVDRSGSG---TVRLQNGDTIKSELGVVVAVEEPE 293 Score = 23.1 bits (48), Expect(2) = 4e-08 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 Query: 79 IAVEEPETIKLLAGKSNGFPVEMKKP 2 +AVEEPE KLL K P E KKP Sbjct: 287 VAVEEPEVAKLLGLK----PAE-KKP 307 >ref|XP_002300057.1| predicted protein [Populus trichocarpa] gi|222847315|gb|EEE84862.1| predicted protein [Populus trichocarpa] Length = 356 Score = 55.5 bits (132), Expect(2) = 5e-08 Identities = 28/58 (48%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = -1 Query: 228 AIPEQLVSKLPSNSIILNTSVASIDKSESESTYT--VRLNNGEVLTSDYGMILQLKNP 61 AIP QL SKLP++SI+LNT V S+ E ++T VRL NG++L S+ G+I+ ++ P Sbjct: 123 AIPNQLASKLPADSILLNTRVVSVGLDEDQNTPMPFVRLENGDILQSELGVIVAVEEP 180 Score = 26.6 bits (57), Expect(2) = 5e-08 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 79 IAVEEPETIKLLAGKSNGFPVEMKKP 2 +AVEEP +LLA ++ PV+ KKP Sbjct: 175 VAVEEPHVNELLAEINSIGPVQSKKP 200 >ref|XP_002515342.1| amine oxidase, putative [Ricinus communis] gi|223545286|gb|EEF46791.1| amine oxidase, putative [Ricinus communis] Length = 481 Score = 51.2 bits (121), Expect(2) = 2e-07 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = -1 Query: 228 AIPEQLVSKLPSNSIILNTSVASIDKSESESTYTVRLNNGEVLTSDYGMILQLKNPK 58 AIP QL +KLP NS+ L+T VASID + + T L +GE++ S+ G+IL ++ P+ Sbjct: 253 AIPNQLAAKLPPNSVFLDTRVASIDIERANPSVT--LQSGEIVQSEMGVILAVEEPE 307 Score = 28.9 bits (63), Expect(2) = 2e-07 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -3 Query: 79 IAVEEPETIKLLAGKSNGFPVEMKKP 2 +AVEEPE KL AG+++ PV+ KKP Sbjct: 301 LAVEEPEVDKLFAGRNDIKPVQ-KKP 325 >ref|XP_003524753.1| PREDICTED: phytoene dehydrogenase, chloroplastic/chromoplastic-like [Glycine max] Length = 476 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = -1 Query: 231 SAIPEQLVSKLPSNSIILNTSVASIDKSESESTYTVRLNNGEVLTSDYGMILQLKNP 61 SAIPEQL ++LPS SI+LN+ S+D S+S VRL NG+VL S+ G+I+ ++ P Sbjct: 248 SAIPEQLAARLPSGSILLNSKAVSVDLDNSDSP-LVRLQNGDVLKSELGVIVAVEEP 303