BLASTX nr result
ID: Atractylodes21_contig00021532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021532 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272269.1| PREDICTED: coatomer subunit beta'-2 [Vitis v... 71 8e-11 ref|XP_004149846.1| PREDICTED: coatomer subunit beta'-2-like [Cu... 70 2e-10 ref|NP_188219.2| coatomer subunit beta'-3 [Arabidopsis thaliana]... 69 4e-10 ref|NP_850592.1| coatomer subunit beta'-3 [Arabidopsis thaliana]... 69 4e-10 ref|NP_175645.1| coatomer subunit beta'-2 [Arabidopsis thaliana]... 69 4e-10 >ref|XP_002272269.1| PREDICTED: coatomer subunit beta'-2 [Vitis vinifera] gi|296081006|emb|CBI18510.3| unnamed protein product [Vitis vinifera] Length = 322 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/73 (45%), Positives = 51/73 (69%) Frame = +2 Query: 2 SILCVHSSDVNYIITGSEDGTVRVWNAKTYNLEHVFASELDKVWTMGFKKDSAQIVLGCD 181 S +CVH ++ IITGSEDG V +W+ TY LE+ + L++VW G K+S ++V+G D Sbjct: 235 SAVCVHP-ELPLIITGSEDGNVHIWDRATYRLENTQSYGLERVWAFGCTKESNRVVIGYD 293 Query: 182 KGTMIGQFISTHS 220 KGT++ + +S+HS Sbjct: 294 KGTIMIKVLSSHS 306 >ref|XP_004149846.1| PREDICTED: coatomer subunit beta'-2-like [Cucumis sativus] Length = 915 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/65 (47%), Positives = 47/65 (72%) Frame = +2 Query: 2 SILCVHSSDVNYIITGSEDGTVRVWNAKTYNLEHVFASELDKVWTMGFKKDSAQIVLGCD 181 S +C H D+ IITGSEDGTVR+W++ TY LE+ L++VW +G+ K S ++V+G D Sbjct: 233 SAVCFHP-DLPIIITGSEDGTVRIWHSTTYRLENTLNYGLERVWAIGYMKSSRRVVIGYD 291 Query: 182 KGTMI 196 +GT++ Sbjct: 292 EGTIM 296 >ref|NP_188219.2| coatomer subunit beta'-3 [Arabidopsis thaliana] gi|30683868|ref|NP_850593.1| coatomer subunit beta'-3 [Arabidopsis thaliana] gi|222422950|dbj|BAH19460.1| AT3G15980 [Arabidopsis thaliana] gi|332642235|gb|AEE75756.1| coatomer subunit beta'-3 [Arabidopsis thaliana] gi|332642236|gb|AEE75757.1| coatomer subunit beta'-3 [Arabidopsis thaliana] Length = 918 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/65 (47%), Positives = 47/65 (72%) Frame = +2 Query: 2 SILCVHSSDVNYIITGSEDGTVRVWNAKTYNLEHVFASELDKVWTMGFKKDSAQIVLGCD 181 S +C H ++ IITGSEDGTVR+W+A TY LE+ L++VW +G+ K S ++V+G D Sbjct: 233 SAVCFHP-ELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYD 291 Query: 182 KGTMI 196 +GT++ Sbjct: 292 EGTIM 296 >ref|NP_850592.1| coatomer subunit beta'-3 [Arabidopsis thaliana] gi|75329793|sp|Q8L828.1|COB23_ARATH RecName: Full=Coatomer subunit beta'-3; AltName: Full=Beta'-coat protein 3; Short=Beta'-COP 3 gi|21539583|gb|AAM53344.1| putative coatomer complex subunit [Arabidopsis thaliana] gi|24899747|gb|AAN65088.1| putative coatomer complex subunit [Arabidopsis thaliana] gi|332642234|gb|AEE75755.1| coatomer subunit beta'-3 [Arabidopsis thaliana] Length = 909 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/65 (47%), Positives = 47/65 (72%) Frame = +2 Query: 2 SILCVHSSDVNYIITGSEDGTVRVWNAKTYNLEHVFASELDKVWTMGFKKDSAQIVLGCD 181 S +C H ++ IITGSEDGTVR+W+A TY LE+ L++VW +G+ K S ++V+G D Sbjct: 233 SAVCFHP-ELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYD 291 Query: 182 KGTMI 196 +GT++ Sbjct: 292 EGTIM 296 >ref|NP_175645.1| coatomer subunit beta'-2 [Arabidopsis thaliana] gi|75169434|sp|Q9C827.1|COB22_ARATH RecName: Full=Coatomer subunit beta'-2; AltName: Full=Beta'-coat protein 2; Short=Beta'-COP 2 gi|12323125|gb|AAG51545.1|AC037424_10 coatomer complex subunit, putative; 33791-27676 [Arabidopsis thaliana] gi|332194671|gb|AEE32792.1| coatomer subunit beta'-2 [Arabidopsis thaliana] Length = 926 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/65 (47%), Positives = 47/65 (72%) Frame = +2 Query: 2 SILCVHSSDVNYIITGSEDGTVRVWNAKTYNLEHVFASELDKVWTMGFKKDSAQIVLGCD 181 S +C H ++ IITGSEDGTVR+W+A TY LE+ L++VW +G+ K S ++V+G D Sbjct: 233 SAVCFHP-ELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYD 291 Query: 182 KGTMI 196 +GT++ Sbjct: 292 EGTIM 296