BLASTX nr result
ID: Atractylodes21_contig00021508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021508 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002463575.1| hypothetical protein SORBIDRAFT_01g002340 [S... 59 4e-07 gb|AEZ52398.1| hypothetical protein, partial [Wolffia australiana] 55 8e-06 >ref|XP_002463575.1| hypothetical protein SORBIDRAFT_01g002340 [Sorghum bicolor] gi|241917429|gb|EER90573.1| hypothetical protein SORBIDRAFT_01g002340 [Sorghum bicolor] Length = 173 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = +3 Query: 135 VGISASTMISATKWSTGLXXXXXXXXXXXLTCWCPCIPFGEIAEIIDKGNT 287 V IS+ ++AT+WS+GL LTCWCPCI FG IAEI+D+G T Sbjct: 25 VPISSPGPVAATEWSSGLCACFDDCGLCCLTCWCPCITFGRIAEIVDRGAT 75 >gb|AEZ52398.1| hypothetical protein, partial [Wolffia australiana] Length = 165 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/39 (53%), Positives = 27/39 (69%) Frame = +3 Query: 171 KWSTGLXXXXXXXXXXXLTCWCPCIPFGEIAEIIDKGNT 287 KW+TGL +TCWCPCI FG+IAEI+D+G+T Sbjct: 31 KWTTGLCDCGDDVGNCCITCWCPCITFGQIAEIVDRGST 69