BLASTX nr result
ID: Atractylodes21_contig00021233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021233 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509542.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_003594927.1| hypothetical protein MTR_2g036320 [Medicago ... 56 3e-06 ref|XP_002319926.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002509542.1| conserved hypothetical protein [Ricinus communis] gi|223549441|gb|EEF50929.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 3/105 (2%) Frame = +2 Query: 2 TPTVLVLRSSKYQV---ISIGLLHREDENVEEFEVQKATYLHHLLDGLVSPPEQILEACL 172 TP +L + K + SIG LH ++N++ E K YL L++ +P +++ E + Sbjct: 46 TPKILSRHNEKAYIPNAFSIGPLHHSNQNLKRTEKIKYKYLRGLINRSENPKKKLREF-I 104 Query: 173 QKVNASIDTIRACYAGMKTYTDDELAKMMVMDGSFILELLYPSSE 307 + + R CYAG+ Y DE KM+V+DG F++EL S+ Sbjct: 105 EAIQRIESEARECYAGLVKYNPDEFVKMLVVDGCFLIELFRKDSK 149 >ref|XP_003594927.1| hypothetical protein MTR_2g036320 [Medicago truncatula] gi|355483975|gb|AES65178.1| hypothetical protein MTR_2g036320 [Medicago truncatula] Length = 510 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/89 (37%), Positives = 49/89 (55%) Frame = +2 Query: 44 ISIGLLHREDENVEEFEVQKATYLHHLLDGLVSPPEQILEACLQKVNASIDTIRACYAGM 223 ISIG H ++++E EV K + H L D + ++ EAC I+ R CY G Sbjct: 89 ISIGPYHYGSQHLQEMEVLKNKFFHRLFDPNGANGSKLEEACKFLEKEEINA-RNCYMGE 147 Query: 224 KTYTDDELAKMMVMDGSFILELLYPSSEH 310 + DE KMM++DGSFI++LL S++ Sbjct: 148 IKLSSDEFLKMMLVDGSFIIQLLRDLSDN 176 >ref|XP_002319926.1| predicted protein [Populus trichocarpa] gi|222858302|gb|EEE95849.1| predicted protein [Populus trichocarpa] Length = 429 Score = 55.1 bits (131), Expect = 6e-06 Identities = 35/84 (41%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = +2 Query: 41 VISIGLLHREDENVEEFEVQKATYLHHLLDGLVSPPEQILEACLQKVNASIDTIRACYA- 217 +ISIG LH ++NV EV K Y+ LL+ P + L+ C + + IRACYA Sbjct: 54 IISIGPLHHGEQNVLAMEVHKWHYMLSLLERTPDPAKS-LDECGKAILRFDKHIRACYAE 112 Query: 218 GMKTYTDDELAKMMVMDGSFILEL 289 + Y +LAKM+++DG FILEL Sbjct: 113 PIDKYEKYDLAKMLLVDGCFILEL 136