BLASTX nr result
ID: Atractylodes21_contig00021211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021211 (717 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299897.1| predicted protein [Populus trichocarpa] gi|2... 70 3e-10 ref|XP_002877438.1| hypothetical protein ARALYDRAFT_484964 [Arab... 62 9e-08 ref|NP_190171.1| P-loop containing nucleoside triphosphate hydro... 62 9e-08 ref|NP_180430.2| P-loop containing nucleoside triphosphate hydro... 61 3e-07 ref|XP_002880998.1| hypothetical protein ARALYDRAFT_481773 [Arab... 61 3e-07 >ref|XP_002299897.1| predicted protein [Populus trichocarpa] gi|222847155|gb|EEE84702.1| predicted protein [Populus trichocarpa] Length = 1077 Score = 70.5 bits (171), Expect = 3e-10 Identities = 42/72 (58%), Positives = 49/72 (68%) Frame = -3 Query: 715 KSAMMKDLYSEIERLKQGCETPLPLLSNLSQ*GSR*LTI*YTGTVA*PEVYAAREKNGIY 536 KSAM+KDLYSEI+RLKQG +LSN+ I + PEVYAAREKNGIY Sbjct: 410 KSAMIKDLYSEIDRLKQGASL-FDILSNV--------LISLKNKI--PEVYAAREKNGIY 458 Query: 535 IPKDRYLQEEEE 500 IP+DRYLQ+E E Sbjct: 459 IPRDRYLQDEAE 470 >ref|XP_002877438.1| hypothetical protein ARALYDRAFT_484964 [Arabidopsis lyrata subsp. lyrata] gi|297323276|gb|EFH53697.1| hypothetical protein ARALYDRAFT_484964 [Arabidopsis lyrata subsp. lyrata] Length = 1056 Score = 62.4 bits (150), Expect = 9e-08 Identities = 37/72 (51%), Positives = 40/72 (55%) Frame = -3 Query: 715 KSAMMKDLYSEIERLKQGCETPLPLLSNLSQ*GSR*LTI*YTGTVA*PEVYAAREKNGIY 536 KSA+MKDLYSEI+RLKQ EVYAAREKNGIY Sbjct: 402 KSAVMKDLYSEIDRLKQ-------------------------------EVYAAREKNGIY 430 Query: 535 IPKDRYLQEEEE 500 IPKDRY+QEE E Sbjct: 431 IPKDRYIQEEAE 442 >ref|NP_190171.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|334185753|ref|NP_001190017.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|7339486|emb|CAB82809.1| kinesin-related protein-like [Arabidopsis thaliana] gi|332644559|gb|AEE78080.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|332644560|gb|AEE78081.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Length = 1058 Score = 62.4 bits (150), Expect = 9e-08 Identities = 37/72 (51%), Positives = 40/72 (55%) Frame = -3 Query: 715 KSAMMKDLYSEIERLKQGCETPLPLLSNLSQ*GSR*LTI*YTGTVA*PEVYAAREKNGIY 536 KSA+MKDLYSEI+RLKQ EVYAAREKNGIY Sbjct: 402 KSAVMKDLYSEIDRLKQ-------------------------------EVYAAREKNGIY 430 Query: 535 IPKDRYLQEEEE 500 IPKDRY+QEE E Sbjct: 431 IPKDRYIQEEAE 442 >ref|NP_180430.2| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|330253056|gb|AEC08150.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Length = 1042 Score = 60.8 bits (146), Expect = 3e-07 Identities = 37/72 (51%), Positives = 39/72 (54%) Frame = -3 Query: 715 KSAMMKDLYSEIERLKQGCETPLPLLSNLSQ*GSR*LTI*YTGTVA*PEVYAAREKNGIY 536 KSA+MKDLYSEIERLKQ EVYAAREKNGIY Sbjct: 404 KSAIMKDLYSEIERLKQ-------------------------------EVYAAREKNGIY 432 Query: 535 IPKDRYLQEEEE 500 IPK+RY QEE E Sbjct: 433 IPKERYTQEEAE 444 >ref|XP_002880998.1| hypothetical protein ARALYDRAFT_481773 [Arabidopsis lyrata subsp. lyrata] gi|297326837|gb|EFH57257.1| hypothetical protein ARALYDRAFT_481773 [Arabidopsis lyrata subsp. lyrata] Length = 1042 Score = 60.8 bits (146), Expect = 3e-07 Identities = 37/72 (51%), Positives = 39/72 (54%) Frame = -3 Query: 715 KSAMMKDLYSEIERLKQGCETPLPLLSNLSQ*GSR*LTI*YTGTVA*PEVYAAREKNGIY 536 KSA+MKDLYSEIERLKQ EVYAAREKNGIY Sbjct: 404 KSAIMKDLYSEIERLKQ-------------------------------EVYAAREKNGIY 432 Query: 535 IPKDRYLQEEEE 500 IPK+RY QEE E Sbjct: 433 IPKERYTQEEAE 444