BLASTX nr result
ID: Atractylodes21_contig00021155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00021155 (706 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625892.1| hypothetical protein MTR_7g108440 [Medicago ... 45 1e-06 >ref|XP_003625892.1| hypothetical protein MTR_7g108440 [Medicago truncatula] gi|355500907|gb|AES82110.1| hypothetical protein MTR_7g108440 [Medicago truncatula] Length = 848 Score = 44.7 bits (104), Expect(2) = 1e-06 Identities = 23/67 (34%), Positives = 36/67 (53%) Frame = +3 Query: 105 LAGQAGVSRFWGYRARDGSPRAALAKGFSKGVASFLFFNFPDDCSYTHLWKVFKRFGRVI 284 + G G+ R + SP A L+ + SF F FP+D ++ LWK+F +FG V Sbjct: 2 IGGGQGLQRQGKEVVKGSSPSARLS---DRDSISFFFTKFPEDAKHSELWKLFAKFGYVG 58 Query: 285 DIYVAKK 305 +++AKK Sbjct: 59 KVFLAKK 65 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 301 KRGERFGFVRFEITMNISDFEDRLNSIWIGLYKLRVFIAR 420 K G +FGFV+++ + + D RL +W +L+V +AR Sbjct: 68 KWGRKFGFVKYKEVIYMEDLATRLEHVWFDNVRLKVNLAR 107