BLASTX nr result
ID: Atractylodes21_contig00020998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020998 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512996.1| Salt-tolerance protein, putative [Ricinus co... 60 1e-07 >ref|XP_002512996.1| Salt-tolerance protein, putative [Ricinus communis] gi|223548007|gb|EEF49499.1| Salt-tolerance protein, putative [Ricinus communis] Length = 212 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +2 Query: 2 GQTSNNQEQGMDI-SGSNNDCASVVPVGSFKREPEK 106 GQ S NQEQGMD+ SGSN++CAS+VPVGSF REPEK Sbjct: 177 GQNSTNQEQGMDVMSGSNHECASIVPVGSFNREPEK 212