BLASTX nr result
ID: Atractylodes21_contig00020900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020900 (619 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135917.1| PREDICTED: SURP and G-patch domain-containin... 66 4e-09 gb|ACA24495.1| gamma reponse I-like protein [Cucumis sativus] 66 4e-09 ref|XP_002513189.1| arginine/serine rich splicing factor sf4/14,... 64 2e-08 emb|CAB41332.1| gamma response I protein [Arabidopsis thaliana] 64 2e-08 ref|NP_001118822.1| Splicing factor 4-like protein [Arabidopsis ... 63 4e-08 >ref|XP_004135917.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein-like [Cucumis sativus] gi|449489072|ref|XP_004158206.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein-like [Cucumis sativus] Length = 446 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 498 VLK*HAAPPCPSDPTIKKVAEKLASFVAKNGRQFEHITRQ 617 VL+ APP PSDPT+KKVA+KLASFVAK+GRQFEH+TRQ Sbjct: 132 VLQSGDAPPSPSDPTVKKVADKLASFVAKHGRQFEHVTRQ 171 >gb|ACA24495.1| gamma reponse I-like protein [Cucumis sativus] Length = 446 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 498 VLK*HAAPPCPSDPTIKKVAEKLASFVAKNGRQFEHITRQ 617 VL+ APP PSDPT+KKVA+KLASFVAK+GRQFEH+TRQ Sbjct: 132 VLQSGDAPPSPSDPTVKKVADKLASFVAKHGRQFEHVTRQ 171 >ref|XP_002513189.1| arginine/serine rich splicing factor sf4/14, putative [Ricinus communis] gi|223547687|gb|EEF49180.1| arginine/serine rich splicing factor sf4/14, putative [Ricinus communis] Length = 441 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 516 APPCPSDPTIKKVAEKLASFVAKNGRQFEHITRQ 617 AP PSDPT+KKVA+KLASFVAKNGRQFEHITRQ Sbjct: 138 APLSPSDPTVKKVADKLASFVAKNGRQFEHITRQ 171 >emb|CAB41332.1| gamma response I protein [Arabidopsis thaliana] Length = 1110 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 510 HAAPPCPSDPTIKKVAEKLASFVAKNGRQFEHITRQ 617 +A+PP PSDPT+KKVA+KLASFVAK+GR FEHITRQ Sbjct: 783 NASPPPPSDPTVKKVADKLASFVAKHGRPFEHITRQ 818 >ref|NP_001118822.1| Splicing factor 4-like protein [Arabidopsis thaliana] gi|332645376|gb|AEE78897.1| Splicing factor 4-like protein [Arabidopsis thaliana] Length = 414 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 516 APPCPSDPTIKKVAEKLASFVAKNGRQFEHITRQ 617 APP PSDPT+KKVA+KLASFVAK+GR FEHITRQ Sbjct: 130 APPPPSDPTVKKVADKLASFVAKHGRPFEHITRQ 163