BLASTX nr result
ID: Atractylodes21_contig00020809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020809 (199 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632138.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl... 57 1e-06 emb|CBI15886.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_002313966.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_004143169.1| PREDICTED: UDP-glycosyltransferase 87A1-like... 55 6e-06 ref|XP_002278049.1| PREDICTED: UDP-glycosyltransferase 87A2-like... 55 8e-06 >ref|XP_003632138.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 87A1-like [Vitis vinifera] Length = 462 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/63 (41%), Positives = 43/63 (68%) Frame = +3 Query: 3 YWPMSASMFTFWYHVDLLQEHHHLYVDLSAGREDEYIDYIPGLCPIKVSEFPVVDQGVHD 182 +W M+AS+F+ ++H DLL ++ H +D+S R DE +DYIPGL ++++FP + + Sbjct: 136 FWTMAASVFSMFHHFDLLLQNGHHPIDISE-RGDERVDYIPGLSATRIADFPALLHHKNP 194 Query: 183 ILP 191 ILP Sbjct: 195 ILP 197 >emb|CBI15886.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/63 (41%), Positives = 43/63 (68%) Frame = +3 Query: 3 YWPMSASMFTFWYHVDLLQEHHHLYVDLSAGREDEYIDYIPGLCPIKVSEFPVVDQGVHD 182 +W M+AS+F+ ++H DLL ++ H +D+S R DE +DYIPGL ++++FP + + Sbjct: 136 FWTMAASVFSMFHHFDLLLQNGHHPIDISE-RGDERVDYIPGLSATRIADFPALLHHKNP 194 Query: 183 ILP 191 ILP Sbjct: 195 ILP 197 >ref|XP_002313966.1| predicted protein [Populus trichocarpa] gi|222850374|gb|EEE87921.1| predicted protein [Populus trichocarpa] Length = 461 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/52 (44%), Positives = 40/52 (76%) Frame = +3 Query: 3 YWPMSASMFTFWYHVDLLQEHHHLYVDLSAGREDEYIDYIPGLCPIKVSEFP 158 ++PMS+++F+ +YH+DLL +H H VDLS + +E +DYIPG+ P+++ + P Sbjct: 140 FFPMSSTVFSVFYHLDLLAQHGHFPVDLSE-KGNEIVDYIPGVSPLRLLDLP 190 >ref|XP_004143169.1| PREDICTED: UDP-glycosyltransferase 87A1-like [Cucumis sativus] gi|449525239|ref|XP_004169625.1| PREDICTED: UDP-glycosyltransferase 87A1-like [Cucumis sativus] Length = 447 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = +3 Query: 6 WPMSASMFTFWYHVDLLQEHHHLYVDLSAGREDEYIDYIPGLCPIKVSEFP 158 WPMSA++F+ YH DLL+E+ H DLS R +E +DY PG+ I++++ P Sbjct: 133 WPMSATVFSILYHFDLLKENGHFPADLSE-RGEEIVDYFPGVSKIRLADLP 182 >ref|XP_002278049.1| PREDICTED: UDP-glycosyltransferase 87A2-like [Vitis vinifera] Length = 460 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/52 (46%), Positives = 39/52 (75%) Frame = +3 Query: 3 YWPMSASMFTFWYHVDLLQEHHHLYVDLSAGREDEYIDYIPGLCPIKVSEFP 158 ++PMSA++F+ ++HVDLL ++ H +D+S R DE +DYIPGL +++FP Sbjct: 131 FFPMSATLFSMFHHVDLLAQNGHHPIDISE-RGDERVDYIPGLSSTLIADFP 181