BLASTX nr result
ID: Atractylodes21_contig00020808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020808 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143169.1| PREDICTED: UDP-glycosyltransferase 87A1-like... 60 1e-07 ref|XP_003632138.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl... 60 1e-07 emb|CBI15886.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_002313966.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_004143221.1| PREDICTED: UDP-glycosyltransferase 87A1-like... 60 2e-07 >ref|XP_004143169.1| PREDICTED: UDP-glycosyltransferase 87A1-like [Cucumis sativus] gi|449525239|ref|XP_004169625.1| PREDICTED: UDP-glycosyltransferase 87A1-like [Cucumis sativus] Length = 447 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/50 (50%), Positives = 36/50 (72%) Frame = +3 Query: 9 WPMSASMFTFWYHVDLLQEHHHLYVDLSGREEEYIDYIPGLCPIKVSEFP 158 WPMSA++F+ YH DLL+E+ H DLS R EE +DY PG+ I++++ P Sbjct: 133 WPMSATVFSILYHFDLLKENGHFPADLSERGEEIVDYFPGVSKIRLADLP 182 >ref|XP_003632138.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 87A1-like [Vitis vinifera] Length = 462 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/63 (39%), Positives = 44/63 (69%) Frame = +3 Query: 3 AYWPMSASMFTFWYHVDLLQEHHHLYVDLSGREEEYIDYIPGLCPIKVSEFPVVDQGVHD 182 ++W M+AS+F+ ++H DLL ++ H +D+S R +E +DYIPGL ++++FP + + Sbjct: 135 SFWTMAASVFSMFHHFDLLLQNGHHPIDISERGDERVDYIPGLSATRIADFPALLHHKNP 194 Query: 183 ILP 191 ILP Sbjct: 195 ILP 197 >emb|CBI15886.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/63 (39%), Positives = 44/63 (69%) Frame = +3 Query: 3 AYWPMSASMFTFWYHVDLLQEHHHLYVDLSGREEEYIDYIPGLCPIKVSEFPVVDQGVHD 182 ++W M+AS+F+ ++H DLL ++ H +D+S R +E +DYIPGL ++++FP + + Sbjct: 135 SFWTMAASVFSMFHHFDLLLQNGHHPIDISERGDERVDYIPGLSATRIADFPALLHHKNP 194 Query: 183 ILP 191 ILP Sbjct: 195 ILP 197 >ref|XP_002313966.1| predicted protein [Populus trichocarpa] gi|222850374|gb|EEE87921.1| predicted protein [Populus trichocarpa] Length = 461 Score = 60.5 bits (145), Expect = 1e-07 Identities = 23/52 (44%), Positives = 40/52 (76%) Frame = +3 Query: 3 AYWPMSASMFTFWYHVDLLQEHHHLYVDLSGREEEYIDYIPGLCPIKVSEFP 158 +++PMS+++F+ +YH+DLL +H H VDLS + E +DYIPG+ P+++ + P Sbjct: 139 SFFPMSSTVFSVFYHLDLLAQHGHFPVDLSEKGNEIVDYIPGVSPLRLLDLP 190 >ref|XP_004143221.1| PREDICTED: UDP-glycosyltransferase 87A1-like [Cucumis sativus] Length = 450 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = +3 Query: 3 AYWPMSASMFTFWYHVDLLQEHHHLYVDLSGREEEYIDYIPGLCPIKVSEFPVVDQG 173 ++WPMS ++ + +YH +LLQE+ H DLS R EE +DYIPG+ ++++ P G Sbjct: 135 SFWPMSVTVLSMYYHFNLLQENGHFPADLSERGEEIVDYIPGVSDTRLADLPTFFSG 191