BLASTX nr result
ID: Atractylodes21_contig00020744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020744 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533072.1| conserved hypothetical protein [Ricinus comm... 47 1e-09 >ref|XP_002533072.1| conserved hypothetical protein [Ricinus communis] gi|223527136|gb|EEF29311.1| conserved hypothetical protein [Ricinus communis] Length = 600 Score = 47.4 bits (111), Expect(2) = 1e-09 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 241 KLEKEAFCREALAYQESQMEEVIEESKRLQQEATNVSKLQEFL 113 KLE+E R ALA QE+ M +V++ESK +QQEA SKL+EFL Sbjct: 434 KLEQEEAARNALAEQEAIMGQVVQESKIIQQEADENSKLREFL 476 Score = 40.0 bits (92), Expect(2) = 1e-09 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -2 Query: 107 LTDRGHVVDMLNGEIFDICGEVNLLKKEFDQ 15 L DRG VVD L GEI IC +V LLK+ FD+ Sbjct: 476 LMDRGRVVDTLQGEISVICQDVRLLKERFDE 506