BLASTX nr result
ID: Atractylodes21_contig00020730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020730 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20763.3| unnamed protein product [Vitis vinifera] 58 8e-07 ref|XP_002280562.1| PREDICTED: uncharacterized protein LOC100267... 58 8e-07 ref|XP_002297698.1| predicted protein [Populus trichocarpa] gi|2... 58 8e-07 ref|XP_002330802.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002332086.1| predicted protein [Populus trichocarpa] gi|2... 55 9e-06 >emb|CBI20763.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 326 LSLLDLAVSKELNPQQLGEDWPVLLEKICTQAFYE 222 +SLLD V+ ELNPQQLGEDWP+LLEKIC Q F E Sbjct: 257 ISLLDFKVAMELNPQQLGEDWPLLLEKICMQTFEE 291 >ref|XP_002280562.1| PREDICTED: uncharacterized protein LOC100267965 [Vitis vinifera] Length = 415 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 326 LSLLDLAVSKELNPQQLGEDWPVLLEKICTQAFYE 222 +SLLD V+ ELNPQQLGEDWP+LLEKIC Q F E Sbjct: 381 ISLLDFKVAMELNPQQLGEDWPLLLEKICMQTFEE 415 >ref|XP_002297698.1| predicted protein [Populus trichocarpa] gi|222844956|gb|EEE82503.1| predicted protein [Populus trichocarpa] Length = 348 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 326 LSLLDLAVSKELNPQQLGEDWPVLLEKICTQ 234 +SLLDL VS ELNPQQLGEDWP+LLEKICT+ Sbjct: 314 ISLLDLKVSMELNPQQLGEDWPLLLEKICTR 344 >ref|XP_002330802.1| predicted protein [Populus trichocarpa] gi|222872604|gb|EEF09735.1| predicted protein [Populus trichocarpa] Length = 291 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 326 LSLLDLAVSKELNPQQLGEDWPVLLEKICTQAF 228 +S+LD V+ ELNPQQLGEDWP+LLEKIC Q+F Sbjct: 257 ISMLDFKVAMELNPQQLGEDWPLLLEKICMQSF 289 >ref|XP_002332086.1| predicted protein [Populus trichocarpa] gi|222874906|gb|EEF12037.1| predicted protein [Populus trichocarpa] Length = 384 Score = 54.7 bits (130), Expect = 9e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 326 LSLLDLAVSKELNPQQLGEDWPVLLEKICTQAF 228 +S+LD V+ ELNPQQLGEDWP+LLEKIC +F Sbjct: 350 ISMLDFKVAMELNPQQLGEDWPLLLEKICMHSF 382