BLASTX nr result
ID: Atractylodes21_contig00020665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020665 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002462025.1| hypothetical protein SORBIDRAFT_02g012940 [S... 73 1e-12 ref|NP_567094.1| dynamin-related protein 1E [Arabidopsis thalian... 76 3e-12 ref|XP_003633899.1| PREDICTED: dynamin-related protein 1E [Vitis... 76 3e-12 ref|XP_002265553.2| PREDICTED: dynamin-related protein 1E isofor... 76 3e-12 ref|XP_003574360.1| PREDICTED: dynamin-related protein 1E-like [... 76 3e-12 >ref|XP_002462025.1| hypothetical protein SORBIDRAFT_02g012940 [Sorghum bicolor] gi|241925402|gb|EER98546.1| hypothetical protein SORBIDRAFT_02g012940 [Sorghum bicolor] Length = 624 Score = 72.8 bits (177), Expect(2) = 1e-12 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = -3 Query: 217 RRGGD*IYGVFDN*LSAAIRNLPFDRYLSLQSMWELVSEPYGYLPLLIAPEQGY 56 R GGD IYGVFD+ L AA + LPFDRYLS+Q++ ++VSE GY P LIAPEQGY Sbjct: 357 RSGGDRIYGVFDHKLPAAFKKLPFDRYLSVQNVKKVVSEADGYQPHLIAPEQGY 410 Score = 24.6 bits (52), Expect(2) = 1e-12 Identities = 13/18 (72%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = -1 Query: 51 YRHLIE-GSLIFRGPAEA 1 YR LIE G FRGPAEA Sbjct: 410 YRRLIEKGITYFRGPAEA 427 >ref|NP_567094.1| dynamin-related protein 1E [Arabidopsis thaliana] gi|59799367|sp|Q9FNX5.1|DRP1E_ARATH RecName: Full=Dynamin-related protein 1E; AltName: Full=Dynamin-like protein 4; AltName: Full=Dynamin-like protein DLP2; AltName: Full=Dynamin-like protein E gi|16226788|gb|AAL16262.1|AF428332_1 AT3g60190/T2O9_170 [Arabidopsis thaliana] gi|11991508|emb|CAC19657.1| dynamin-like protein DLP2 [Arabidopsis thaliana] gi|332646501|gb|AEE80022.1| dynamin-related protein 1E [Arabidopsis thaliana] Length = 624 Score = 75.9 bits (185), Expect = 3e-12 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -3 Query: 217 RRGGD*IYGVFDN*LSAAIRNLPFDRYLSLQSMWELVSEPYGYLPLLIAPEQGY 56 R GGD IYGVFDN L AA++ LPFDR+LSLQS+ ++VSE GY P LIAPEQGY Sbjct: 360 RPGGDRIYGVFDNQLPAALKKLPFDRHLSLQSVKKIVSEADGYQPHLIAPEQGY 413 >ref|XP_003633899.1| PREDICTED: dynamin-related protein 1E [Vitis vinifera] Length = 613 Score = 75.9 bits (185), Expect = 3e-12 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -3 Query: 217 RRGGD*IYGVFDN*LSAAIRNLPFDRYLSLQSMWELVSEPYGYLPLLIAPEQGY 56 R GGD IYGVFDN L AA+R LPFDR+LSLQ++ ++VSE GY P LIAPEQGY Sbjct: 358 RPGGDRIYGVFDNQLPAALRKLPFDRHLSLQNVRKIVSEADGYQPHLIAPEQGY 411 >ref|XP_002265553.2| PREDICTED: dynamin-related protein 1E isoform 2 [Vitis vinifera] Length = 602 Score = 75.9 bits (185), Expect = 3e-12 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -3 Query: 217 RRGGD*IYGVFDN*LSAAIRNLPFDRYLSLQSMWELVSEPYGYLPLLIAPEQGY 56 R GGD IYGVFDN L AA+R LPFDR+LSLQ++ ++VSE GY P LIAPEQGY Sbjct: 341 RPGGDRIYGVFDNQLPAALRKLPFDRHLSLQNVRKIVSEADGYQPHLIAPEQGY 394 >ref|XP_003574360.1| PREDICTED: dynamin-related protein 1E-like [Brachypodium distachyon] Length = 615 Score = 75.9 bits (185), Expect = 3e-12 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -3 Query: 217 RRGGD*IYGVFDN*LSAAIRNLPFDRYLSLQSMWELVSEPYGYLPLLIAPEQGY 56 R GGD IYGVFDN L +A+R LPFDRYLSLQ++ +VSE GY P LIAPEQGY Sbjct: 357 RPGGDRIYGVFDNQLPSALRKLPFDRYLSLQNVKRVVSEADGYQPHLIAPEQGY 410