BLASTX nr result
ID: Atractylodes21_contig00020407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020407 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG22120.1| polyprotein [Cynara cardunculus var. scolymus] 65 4e-09 emb|CAN80871.1| hypothetical protein VITISV_038793 [Vitis vinifera] 55 8e-06 emb|CAN69205.1| hypothetical protein VITISV_036606 [Vitis vinifera] 55 8e-06 >gb|ABG22120.1| polyprotein [Cynara cardunculus var. scolymus] Length = 349 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 364 YQADPKESHMAAVKRIFRYMKGSSEFGLWYPKNSGLVLS 480 YQA+PKESH+AAVKRIFRY+KG+ GLWYPK+SG L+ Sbjct: 208 YQANPKESHLAAVKRIFRYLKGTPNLGLWYPKDSGFDLT 246 >emb|CAN80871.1| hypothetical protein VITISV_038793 [Vitis vinifera] Length = 401 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 364 YQADPKESHMAAVKRIFRYMKGSSEFGLWYPKNSGLVL 477 +Q+ PKESH++AVKRI RY+KG+ + GLWYPK+ L Sbjct: 52 FQSCPKESHLSAVKRILRYLKGTMDMGLWYPKSDNFEL 89 >emb|CAN69205.1| hypothetical protein VITISV_036606 [Vitis vinifera] Length = 371 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 364 YQADPKESHMAAVKRIFRYMKGSSEFGLWYPKNSGLVL 477 +Q+ PKESH++AVKRI RY+KG+ + GLWYPK+ L Sbjct: 96 FQSCPKESHLSAVKRILRYLKGTMDMGLWYPKSDNFEL 133