BLASTX nr result
ID: Atractylodes21_contig00020137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00020137 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003557479.1| PREDICTED: BI1-like protein-like [Brachypodi... 142 2e-32 ref|NP_191890.1| BAX inhibitor-1 motif-containing protein [Arabi... 142 3e-32 ref|XP_002878509.1| glutamate binding protein [Arabidopsis lyrat... 141 6e-32 emb|CAI53895.2| putative receptor associated protein [Capsicum c... 140 8e-32 ref|NP_001149807.1| transmembrane BAX inhibitor motif-containing... 140 1e-31 >ref|XP_003557479.1| PREDICTED: BI1-like protein-like [Brachypodium distachyon] Length = 242 Score = 142 bits (359), Expect = 2e-32 Identities = 67/83 (80%), Positives = 78/83 (93%) Frame = -3 Query: 251 ALAFGIGLSCAFTSGKVILEAVILTAVVVVSLTLFTFWAAKRGSDFNFLGPFLFGALMVL 72 +++F +G++CAFTSGKVILEA ILTAVVV+SLT +TFWAAKRG DFNFLGPFLFG+LMVL Sbjct: 108 SISFAVGMTCAFTSGKVILEAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFGSLMVL 167 Query: 71 IVFSFIQIFFPLGKISVMIYAGL 3 IVFSFIQIFFPLGK+SVMIY G+ Sbjct: 168 IVFSFIQIFFPLGKLSVMIYGGV 190 >ref|NP_191890.1| BAX inhibitor-1 motif-containing protein [Arabidopsis thaliana] gi|7523413|emb|CAB86432.1| putative protein [Arabidopsis thaliana] gi|56121898|gb|AAV74230.1| At3g63310 [Arabidopsis thaliana] gi|60543339|gb|AAX22267.1| At3g63310 [Arabidopsis thaliana] gi|332646945|gb|AEE80466.1| BAX inhibitor-1 motif-containing protein [Arabidopsis thaliana] Length = 239 Score = 142 bits (358), Expect = 3e-32 Identities = 70/83 (84%), Positives = 78/83 (93%) Frame = -3 Query: 251 ALAFGIGLSCAFTSGKVILEAVILTAVVVVSLTLFTFWAAKRGSDFNFLGPFLFGALMVL 72 ALAF +GL+CAFTSGKVILE+VILTAVVV+SLTL+TFWAAKRG DFNFLGPFLFGA++VL Sbjct: 105 ALAFAVGLTCAFTSGKVILESVILTAVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVL 164 Query: 71 IVFSFIQIFFPLGKISVMIYAGL 3 +VFSFIQI FPLGKISVMIY L Sbjct: 165 MVFSFIQILFPLGKISVMIYGCL 187 >ref|XP_002878509.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata] gi|297324347|gb|EFH54768.1| glutamate binding protein [Arabidopsis lyrata subsp. lyrata] Length = 239 Score = 141 bits (355), Expect = 6e-32 Identities = 69/83 (83%), Positives = 78/83 (93%) Frame = -3 Query: 251 ALAFGIGLSCAFTSGKVILEAVILTAVVVVSLTLFTFWAAKRGSDFNFLGPFLFGALMVL 72 ALAF +GL+CAFTSGKVILE+VILT+VVV+SLTL+TFWAAKRG DFNFLGPFLFGA++VL Sbjct: 105 ALAFAVGLTCAFTSGKVILESVILTSVVVISLTLYTFWAAKRGHDFNFLGPFLFGAVIVL 164 Query: 71 IVFSFIQIFFPLGKISVMIYAGL 3 +VFSFIQI FPLGKISVMIY L Sbjct: 165 MVFSFIQILFPLGKISVMIYGCL 187 >emb|CAI53895.2| putative receptor associated protein [Capsicum chinense] Length = 242 Score = 140 bits (354), Expect = 8e-32 Identities = 68/83 (81%), Positives = 76/83 (91%) Frame = -3 Query: 251 ALAFGIGLSCAFTSGKVILEAVILTAVVVVSLTLFTFWAAKRGSDFNFLGPFLFGALMVL 72 +LAF +GL+CAFTSGKVILEAVILT VV+SLT +TFWAAKRG DFNFLGPFLFGAL+VL Sbjct: 108 SLAFTVGLTCAFTSGKVILEAVILTTAVVISLTAYTFWAAKRGQDFNFLGPFLFGALVVL 167 Query: 71 IVFSFIQIFFPLGKISVMIYAGL 3 ++FS IQIFFPLGKISVMIY GL Sbjct: 168 LLFSLIQIFFPLGKISVMIYGGL 190 >ref|NP_001149807.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays] gi|195634785|gb|ACG36861.1| transmembrane BAX inhibitor motif-containing protein 4 [Zea mays] gi|238013514|gb|ACR37792.1| unknown [Zea mays] gi|414873340|tpg|DAA51897.1| TPA: Transmembrane BAX inhibitor motif protein-containing protein 4 [Zea mays] Length = 243 Score = 140 bits (352), Expect = 1e-31 Identities = 66/83 (79%), Positives = 76/83 (91%) Frame = -3 Query: 251 ALAFGIGLSCAFTSGKVILEAVILTAVVVVSLTLFTFWAAKRGSDFNFLGPFLFGALMVL 72 A++F +G++CAFTSGK+ILEA ILTAVVV+SLT +TFWAAKRG DFNFLGPFLF A+MVL Sbjct: 109 AISFAVGMTCAFTSGKIILEAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAAIMVL 168 Query: 71 IVFSFIQIFFPLGKISVMIYAGL 3 +VFS IQIFFPLGKISVMIY GL Sbjct: 169 MVFSLIQIFFPLGKISVMIYGGL 191