BLASTX nr result
ID: Atractylodes21_contig00019938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019938 (487 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71234.1| hypothetical protein VITISV_019908 [Vitis vinifera] 61 8e-08 >emb|CAN71234.1| hypothetical protein VITISV_019908 [Vitis vinifera] Length = 574 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/64 (45%), Positives = 41/64 (64%) Frame = +1 Query: 295 ASHLRLLKPCIRDEVASKEVEVTYIPS*KQTVDVLTKSLLIDTFYYLKGKRPVVSPPQHS 474 A H+ + I D+V +KE+E+ Y+P+ QT D+ TKSL I F++LKGK +V PQ Sbjct: 173 AKHIEIDVHFIGDKVIAKELEIKYVPTKDQTADIFTKSLSISQFHFLKGKLAIVQSPQSR 232 Query: 475 LRVH 486 LR H Sbjct: 233 LREH 236