BLASTX nr result
ID: Atractylodes21_contig00019865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019865 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528808.1| ubiquitin ligase protein cop1, putative [Ric... 103 1e-20 gb|AAW28081.1| COP1-like protein [Solanum lycopersicum] 101 5e-20 ref|NP_568435.2| transducin/WD40 domain-containing protein [Arab... 92 6e-17 ref|XP_002872071.1| nucleotide binding protein [Arabidopsis lyra... 92 6e-17 ref|XP_002321910.1| predicted protein [Populus trichocarpa] gi|2... 92 6e-17 >ref|XP_002528808.1| ubiquitin ligase protein cop1, putative [Ricinus communis] gi|223531761|gb|EEF33581.1| ubiquitin ligase protein cop1, putative [Ricinus communis] Length = 426 Score = 103 bits (257), Expect = 1e-20 Identities = 41/62 (66%), Positives = 54/62 (87%) Frame = -3 Query: 363 SNQVFIYDKRWSEPIWVHGFEPRSEYGFVSSICWSQEGEDECTLVSGGPDGVVKIFSGKR 184 +NQVF+YDKRWSEPIW +G P +++GFV+S+CWSQ GED CTLV+GG +GV+++F GKR Sbjct: 360 NNQVFVYDKRWSEPIWAYGSGPAADHGFVNSVCWSQVGEDRCTLVTGGSNGVLQVFEGKR 419 Query: 183 KP 178 KP Sbjct: 420 KP 421 >gb|AAW28081.1| COP1-like protein [Solanum lycopersicum] Length = 120 Score = 101 bits (252), Expect = 5e-20 Identities = 40/61 (65%), Positives = 54/61 (88%) Frame = -3 Query: 363 SNQVFIYDKRWSEPIWVHGFEPRSEYGFVSSICWSQEGEDECTLVSGGPDGVVKIFSGKR 184 +NQVF+YDKRW EPIW++G EPR E+GFVSS+CW Q+ E++CTLV+G DGV+++F+GKR Sbjct: 60 NNQVFVYDKRWGEPIWMYGREPRHEHGFVSSVCWQQKDENQCTLVAGDSDGVLRVFNGKR 119 Query: 183 K 181 K Sbjct: 120 K 120 >ref|NP_568435.2| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|10176840|dbj|BAB10046.1| unnamed protein product [Arabidopsis thaliana] gi|332005822|gb|AED93205.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 368 Score = 91.7 bits (226), Expect = 6e-17 Identities = 38/67 (56%), Positives = 52/67 (77%), Gaps = 5/67 (7%) Frame = -3 Query: 363 SNQVFIYDKRWSEPIWVHGFEP-----RSEYGFVSSICWSQEGEDECTLVSGGPDGVVKI 199 +N+VF+YD+RW +P+WV GFEP S+ FVSS+CW Q G D+CTLV+GG DGV+++ Sbjct: 302 NNRVFVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQV 361 Query: 198 FSGKRKP 178 + GKRKP Sbjct: 362 YVGKRKP 368 >ref|XP_002872071.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata] gi|297317908|gb|EFH48330.1| nucleotide binding protein [Arabidopsis lyrata subsp. lyrata] Length = 365 Score = 91.7 bits (226), Expect = 6e-17 Identities = 38/67 (56%), Positives = 52/67 (77%), Gaps = 5/67 (7%) Frame = -3 Query: 363 SNQVFIYDKRWSEPIWVHGFEP-----RSEYGFVSSICWSQEGEDECTLVSGGPDGVVKI 199 +N+VF+YD+RW +P+WV GFEP S+ FVSS+CW Q G D+CTLV+GG DGV+++ Sbjct: 299 NNRVFVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQV 358 Query: 198 FSGKRKP 178 + GKRKP Sbjct: 359 YVGKRKP 365 >ref|XP_002321910.1| predicted protein [Populus trichocarpa] gi|222868906|gb|EEF06037.1| predicted protein [Populus trichocarpa] Length = 244 Score = 91.7 bits (226), Expect = 6e-17 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 6/70 (8%) Frame = -3 Query: 363 SNQVFIYDKRWSEPIWVHGF------EPRSEYGFVSSICWSQEGEDECTLVSGGPDGVVK 202 +N+VF+YDKRWSEP+WVH + R GFVSS+CW Q GED+CTLV+GG DG+++ Sbjct: 174 NNKVFVYDKRWSEPVWVHESSSPIMGKDRCGSGFVSSVCWRQVGEDQCTLVTGGSDGILQ 233 Query: 201 IFSGKRKPLT 172 +F GKRK T Sbjct: 234 VFRGKRKTRT 243