BLASTX nr result
ID: Atractylodes21_contig00019831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019831 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510008.1| receptor protein kinase, putative [Ricinus c... 68 7e-10 gb|ACI42311.1| putative leucine rich repeat transmembrane protei... 66 3e-09 gb|AEP84281.1| leucine rich repeat-containing protein [Corchorus... 65 6e-09 ref|XP_002283600.2| PREDICTED: receptor-like protein kinase HSL1... 57 2e-06 emb|CBI19329.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_002510008.1| receptor protein kinase, putative [Ricinus communis] gi|223550709|gb|EEF52195.1| receptor protein kinase, putative [Ricinus communis] Length = 956 Score = 68.2 bits (165), Expect = 7e-10 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -1 Query: 382 KVLRIAILCTCKTATLRPSMNEVVQLLIQADPCRVVDTCKSSNKTTE 242 +VLRIAI C CKT RP+MNEVVQLLI+ADPCR D+CKSSNK E Sbjct: 898 QVLRIAIRCICKTPAPRPTMNEVVQLLIEADPCR-FDSCKSSNKAKE 943 >gb|ACI42311.1| putative leucine rich repeat transmembrane protein kinase [Corchorus olitorius] Length = 957 Score = 66.2 bits (160), Expect = 3e-09 Identities = 34/48 (70%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 382 KVLRIAILCTCKTATLRPSMNEVVQLLIQADPCRVVDTCK-SSNKTTE 242 +VLRIA+ CTCK + RP+MNEVVQLLI+ADPCR +D+CK SSNKT E Sbjct: 897 QVLRIAMRCTCKNPSQRPTMNEVVQLLIEADPCR-LDSCKLSSNKTKE 943 >gb|AEP84281.1| leucine rich repeat-containing protein [Corchorus capsularis] Length = 958 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/48 (68%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 382 KVLRIAILCTCKTATLRPSMNEVVQLLIQADPCRVVDTCK-SSNKTTE 242 +VLRIA+ CTCK + RP+MNEVVQLLI+ADPCR +D+CK +SNKT E Sbjct: 898 QVLRIAMRCTCKNPSQRPTMNEVVQLLIEADPCR-LDSCKLTSNKTKE 944 >ref|XP_002283600.2| PREDICTED: receptor-like protein kinase HSL1-like [Vitis vinifera] Length = 956 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -1 Query: 382 KVLRIAILCTCKTATLRPSMNEVVQLLIQADPCRVVDTCKSSNKTTE 242 ++LRI + CT + LRP+MNEV QLL +ADPCR VD+CK S KT E Sbjct: 898 QMLRIGLRCTSSSPALRPTMNEVAQLLTEADPCR-VDSCKLSCKTKE 943 >emb|CBI19329.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -1 Query: 382 KVLRIAILCTCKTATLRPSMNEVVQLLIQADPCRVVDTCKSSNKTTE 242 ++LRI + CT + LRP+MNEV QLL +ADPCR VD+CK S KT E Sbjct: 586 QMLRIGLRCTSSSPALRPTMNEVAQLLTEADPCR-VDSCKLSCKTKE 631