BLASTX nr result
ID: Atractylodes21_contig00019737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019737 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246... 69 4e-10 emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] 69 4e-10 ref|XP_002531719.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246918 [Vitis vinifera] Length = 604 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -3 Query: 158 RKPSRMSLSGSREKDKFLPFLCRYLSRKKVVMLILVSFALMAFLSGFFTVNR 3 RKPS+M SGSREK++ LP+L R+LSR++V MLILV FA + FLSGF TV++ Sbjct: 33 RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFLSGFSTVSK 84 >emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] Length = 616 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -3 Query: 158 RKPSRMSLSGSREKDKFLPFLCRYLSRKKVVMLILVSFALMAFLSGFFTVNR 3 RKPS+M SGSREK++ LP+L R+LSR++V MLILV FA + FLSGF TV++ Sbjct: 33 RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFLSGFSTVSK 84 >ref|XP_002531719.1| conserved hypothetical protein [Ricinus communis] gi|223528662|gb|EEF30678.1| conserved hypothetical protein [Ricinus communis] Length = 500 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/53 (50%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -3 Query: 158 RKPSRMSLSGSREKDKFLPFLC-RYLSRKKVVMLILVSFALMAFLSGFFTVNR 3 RKPS L ++KD F+PF+C RYL RK+V M++LV+FAL+ F+ G F V++ Sbjct: 20 RKPSSKMLVRDKDKDHFIPFICCRYLGRKRVAMVLLVTFALLVFIWGSFPVSK 72