BLASTX nr result
ID: Atractylodes21_contig00019712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019712 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273406.1| PREDICTED: uncharacterized protein LOC100257... 72 5e-11 ref|XP_004149236.1| PREDICTED: uncharacterized protein LOC101213... 70 2e-10 ref|XP_003538461.1| PREDICTED: uncharacterized protein LOC100795... 67 1e-09 ref|XP_003600880.1| hypothetical protein MTR_3g070400 [Medicago ... 67 1e-09 ref|XP_002534435.1| hydrolase, putative [Ricinus communis] gi|22... 65 6e-09 >ref|XP_002273406.1| PREDICTED: uncharacterized protein LOC100257064 isoform 1 [Vitis vinifera] gi|297736619|emb|CBI25490.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 6 SCRERRKLLVYKIDVEAVSTFKNGFPRYSKILQDERIK 119 SCRERRKLLVYKID+EAVS +KNGFPRY KILQ+ER+K Sbjct: 164 SCRERRKLLVYKIDIEAVSAYKNGFPRYQKILQEERVK 201 >ref|XP_004149236.1| PREDICTED: uncharacterized protein LOC101213138 isoform 1 [Cucumis sativus] gi|449463030|ref|XP_004149237.1| PREDICTED: uncharacterized protein LOC101213138 isoform 2 [Cucumis sativus] gi|449520685|ref|XP_004167364.1| PREDICTED: uncharacterized LOC101213138 isoform 1 [Cucumis sativus] gi|449520687|ref|XP_004167365.1| PREDICTED: uncharacterized LOC101213138 isoform 2 [Cucumis sativus] Length = 207 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 3 TSCRERRKLLVYKIDVEAVSTFKNGFPRYSKILQDERIK 119 TSCRERRKLLVYKID+EAVS K+GFPRY KILQ+ER+K Sbjct: 169 TSCRERRKLLVYKIDIEAVSACKSGFPRYQKILQEERVK 207 >ref|XP_003538461.1| PREDICTED: uncharacterized protein LOC100795655 [Glycine max] Length = 205 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 TSCRERRKLLVYKIDVEAVSTFKNGFPRYSKILQDERIK 119 TSCRERRKLLVYKID+EA+S KNG+PRY KI Q+ERIK Sbjct: 167 TSCRERRKLLVYKIDIEAISACKNGYPRYLKIPQEERIK 205 >ref|XP_003600880.1| hypothetical protein MTR_3g070400 [Medicago truncatula] gi|355489928|gb|AES71131.1| hypothetical protein MTR_3g070400 [Medicago truncatula] Length = 216 Score = 67.0 bits (162), Expect = 1e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 3 TSCRERRKLLVYKIDVEAVSTFKNGFPRYSKILQDERIK 119 TSCRERRKLLVYKID+E++S NG+PRY KILQ+ERIK Sbjct: 178 TSCRERRKLLVYKIDIESISACTNGYPRYPKILQEERIK 216 >ref|XP_002534435.1| hydrolase, putative [Ricinus communis] gi|223525303|gb|EEF27950.1| hydrolase, putative [Ricinus communis] Length = 253 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 TSCRERRKLLVYKIDVEAVSTFKNGFPRYSKILQDERIK 119 TSCRERRKLLVYKID+EAVS KNGFP Y KI ++ER+K Sbjct: 173 TSCRERRKLLVYKIDIEAVSACKNGFPGYKKIPKEERVK 211