BLASTX nr result
ID: Atractylodes21_contig00019473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019473 (684 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001154611.1| Ribosomal protein S5/Elongation factor G/III... 43 4e-08 ref|NP_001189873.1| Ribosomal protein S5/Elongation factor G/III... 43 4e-08 >ref|NP_001154611.1| Ribosomal protein S5/Elongation factor G/III/V family protein [Arabidopsis thaliana] gi|332641739|gb|AEE75260.1| Ribosomal protein S5/Elongation factor G/III/V family protein [Arabidopsis thaliana] Length = 820 Score = 43.1 bits (100), Expect(2) = 4e-08 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 243 LLVVESFGLSG---AATLGQAFLQSVVDHLDMMSSNLQEKRFEGA 118 L VVESFG SG AAT GQAF Q V DH DMMSS+ E + A Sbjct: 750 LPVVESFGFSGQLRAATSGQAFPQCVFDHWDMMSSDPLETGSQAA 794 Score = 40.0 bits (92), Expect(2) = 4e-08 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = -2 Query: 416 VWCQQEWGTPVCLPPADAT*QIQSPLCAASQQTLDMN*RRGNMFE-MQRPGTPLYNIKSC 240 ++ Q P L P +IQ+P A +N +RG++FE MQRPGTPLYNIK+ Sbjct: 691 IYASQLTAKPRLLEPVYMV-EIQAPEGALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAY 749 Query: 239 L 237 L Sbjct: 750 L 750 >ref|NP_001189873.1| Ribosomal protein S5/Elongation factor G/III/V family protein [Arabidopsis thaliana] gi|332641740|gb|AEE75261.1| Ribosomal protein S5/Elongation factor G/III/V family protein [Arabidopsis thaliana] Length = 767 Score = 43.1 bits (100), Expect(2) = 4e-08 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 243 LLVVESFGLSG---AATLGQAFLQSVVDHLDMMSSNLQEKRFEGA 118 L VVESFG SG AAT GQAF Q V DH DMMSS+ E + A Sbjct: 697 LPVVESFGFSGQLRAATSGQAFPQCVFDHWDMMSSDPLETGSQAA 741 Score = 40.0 bits (92), Expect(2) = 4e-08 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = -2 Query: 416 VWCQQEWGTPVCLPPADAT*QIQSPLCAASQQTLDMN*RRGNMFE-MQRPGTPLYNIKSC 240 ++ Q P L P +IQ+P A +N +RG++FE MQRPGTPLYNIK+ Sbjct: 638 IYASQLTAKPRLLEPVYMV-EIQAPEGALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAY 696 Query: 239 L 237 L Sbjct: 697 L 697