BLASTX nr result
ID: Atractylodes21_contig00019455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019455 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT08959.1| CC-NBS-LRR [Helianthus annuus] 57 2e-06 >gb|AAT08959.1| CC-NBS-LRR [Helianthus annuus] Length = 1286 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 110 TDLRIYDFEKLESLSMGLQHLTSLQHLYIHNCPKM 6 T L I +F+KLESLS GLQHLTSLQHL IH CPK+ Sbjct: 1231 TSLAIIEFDKLESLSTGLQHLTSLQHLTIHRCPKV 1265