BLASTX nr result
ID: Atractylodes21_contig00019442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019442 (749 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD09588.1| translation initiation factor-related [Trifolium ... 52 3e-06 >gb|ADD09588.1| translation initiation factor-related [Trifolium repens] Length = 617 Score = 52.4 bits (124), Expect(2) = 3e-06 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -3 Query: 747 GKAASAVELAQAFSKSVSDPKVAADRFPGPRGL-PGQGQIP 628 G+ ASAVELAQAFSKSVSDPKV DRF G RGL G+ Q+P Sbjct: 562 GRGASAVELAQAFSKSVSDPKV-NDRFSGQRGLNSGRNQMP 601 Score = 25.0 bits (53), Expect(2) = 3e-06 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 553 FSRLTTLPTTRPQINGH 503 FSRL PT+RPQING+ Sbjct: 602 FSRLVG-PTSRPQINGY 617