BLASTX nr result
ID: Atractylodes21_contig00019407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019407 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15973.3| unnamed protein product [Vitis vinifera] 92 4e-17 ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containi... 92 4e-17 ref|XP_002314110.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 ref|NP_180537.1| pentatricopeptide repeat-containing protein [Ar... 88 8e-16 dbj|BAK07481.1| predicted protein [Hordeum vulgare subsp. vulgare] 86 2e-15 >emb|CBI15973.3| unnamed protein product [Vitis vinifera] Length = 652 Score = 92.0 bits (227), Expect = 4e-17 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 310 LRVCGDCHNVAKLISKLYDREILLRDRYRFHHFKAGDCSCKDYW 179 LRVCGDCH+VAKL+SKLYDREILLRDRYRFHHF+ G CSC DYW Sbjct: 609 LRVCGDCHSVAKLVSKLYDREILLRDRYRFHHFREGHCSCMDYW 652 >ref|XP_002279360.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 743 Score = 92.0 bits (227), Expect = 4e-17 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 310 LRVCGDCHNVAKLISKLYDREILLRDRYRFHHFKAGDCSCKDYW 179 LRVCGDCH+VAKL+SKLYDREILLRDRYRFHHF+ G CSC DYW Sbjct: 700 LRVCGDCHSVAKLVSKLYDREILLRDRYRFHHFREGHCSCMDYW 743 >ref|XP_002314110.1| predicted protein [Populus trichocarpa] gi|222850518|gb|EEE88065.1| predicted protein [Populus trichocarpa] Length = 738 Score = 89.7 bits (221), Expect = 2e-16 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 310 LRVCGDCHNVAKLISKLYDREILLRDRYRFHHFKAGDCSCKDYW 179 LRVCGDCH+VAKLISKLY+R+ILLRDRYRFHHF G+CSC DYW Sbjct: 695 LRVCGDCHSVAKLISKLYNRDILLRDRYRFHHFSGGNCSCMDYW 738 >ref|NP_180537.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75100656|sp|O82380.1|PP175_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g29760, chloroplastic; Flags: Precursor gi|3582328|gb|AAC35225.1| hypothetical protein [Arabidopsis thaliana] gi|330253207|gb|AEC08301.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 738 Score = 87.8 bits (216), Expect = 8e-16 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 310 LRVCGDCHNVAKLISKLYDREILLRDRYRFHHFKAGDCSCKDYW 179 LRVCGDCH+VAKLIS+LYDREI++RDRYRFHHF+ G CSC D+W Sbjct: 695 LRVCGDCHSVAKLISQLYDREIIVRDRYRFHHFRNGQCSCNDFW 738 >dbj|BAK07481.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 596 Score = 86.3 bits (212), Expect = 2e-15 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 310 LRVCGDCHNVAKLISKLYDREILLRDRYRFHHFKAGDCSCKDYW 179 LR+CGDCH V KLISK+YDREI++RDR RFHHFK G+CSCKDYW Sbjct: 553 LRMCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCKDYW 596