BLASTX nr result
ID: Atractylodes21_contig00019298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019298 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147438.1| PREDICTED: uncharacterized protein LOC101217... 55 8e-06 >ref|XP_004147438.1| PREDICTED: uncharacterized protein LOC101217056 [Cucumis sativus] gi|449527135|ref|XP_004170568.1| PREDICTED: uncharacterized LOC101217056 [Cucumis sativus] Length = 231 Score = 54.7 bits (130), Expect = 8e-06 Identities = 36/77 (46%), Positives = 41/77 (53%), Gaps = 11/77 (14%) Frame = +2 Query: 20 HRLFFSSLKQVEKRLKLDDGN-----------PPETTQTQATESFSSSPIYLYNQSTNAS 166 H FFSSLKQVEKRLKLD + P T + E S+P+YL+ TN S Sbjct: 12 HSNFFSSLKQVEKRLKLDHSSQRDVLHPPPPLPVRTNSSSTEEDSLSTPMYLHFPQTNTS 71 Query: 167 STLQADSIQQPAQEFLS 217 STLQ S Q EFLS Sbjct: 72 STLQESS--QAPLEFLS 86