BLASTX nr result
ID: Atractylodes21_contig00019081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00019081 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302931.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 emb|CBI15328.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002514631.1| pentatricopeptide repeat-containing protein,... 72 6e-11 ref|XP_004138218.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 >ref|XP_002302931.1| predicted protein [Populus trichocarpa] gi|222844657|gb|EEE82204.1| predicted protein [Populus trichocarpa] Length = 516 Score = 73.9 bits (180), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -3 Query: 458 FMKKPTAVK-EKKRETLPEKMARKRRRLEKIRLSFVKKPKKAQRLA 324 FMKKP AVK EKKRETLPEKMARKRRRL++IRLSFVKKPKK R A Sbjct: 470 FMKKPKAVKKEKKRETLPEKMARKRRRLKQIRLSFVKKPKKGMRRA 515 >ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Vitis vinifera] Length = 516 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/44 (84%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 458 FMKKPT-AVKEKKRETLPEKMARKRRRLEKIRLSFVKKPKKAQR 330 F+KKPT A KEKKRETLPEKMARKRRRL KIRLSFVKKPK+ +R Sbjct: 471 FVKKPTVAKKEKKRETLPEKMARKRRRLRKIRLSFVKKPKRMRR 514 >emb|CBI15328.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/44 (84%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 458 FMKKPT-AVKEKKRETLPEKMARKRRRLEKIRLSFVKKPKKAQR 330 F+KKPT A KEKKRETLPEKMARKRRRL KIRLSFVKKPK+ +R Sbjct: 487 FVKKPTVAKKEKKRETLPEKMARKRRRLRKIRLSFVKKPKRMRR 530 >ref|XP_002514631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546235|gb|EEF47737.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 569 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/44 (84%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 458 FMKKPTAVK-EKKRETLPEKMARKRRRLEKIRLSFVKKPKKAQR 330 +MKKP AVK EKKRETLPEKMARKRRRL++IRLSFVKKPKK R Sbjct: 523 YMKKPKAVKKEKKRETLPEKMARKRRRLKQIRLSFVKKPKKMMR 566 >ref|XP_004138218.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Cucumis sativus] gi|449477122|ref|XP_004154936.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Cucumis sativus] Length = 522 Score = 63.2 bits (152), Expect = 2e-08 Identities = 32/47 (68%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -3 Query: 458 FMKKPTAVK-EKKRETLPEKMARKRRRLEKIRLSFVKKPKKAQRLAY 321 ++KKP K KKRETLPEKMARKRRRL++IRLSFVKKP++ R A+ Sbjct: 476 YVKKPKDKKVAKKRETLPEKMARKRRRLKQIRLSFVKKPRRGMRRAF 522