BLASTX nr result
ID: Atractylodes21_contig00018966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018966 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159705.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004135302.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 emb|CBI27550.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_002515001.1| pentatricopeptide repeat-containing protein,... 63 2e-08 >ref|XP_004159705.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Cucumis sativus] Length = 488 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -3 Query: 156 VIAKVQGGRTDDEIFQSLLHDQACSTIPVSHELVCQLLRRFKDDWK 19 +IAKVQ G ++DE+FQSLL D C++I +SH+LV +LL+RFKDDWK Sbjct: 43 IIAKVQVGSSEDEVFQSLLQDPVCNSIQLSHDLVYKLLQRFKDDWK 88 >ref|XP_004135302.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Cucumis sativus] Length = 519 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = -3 Query: 156 VIAKVQGGRTDDEIFQSLLHDQACSTIPVSHELVCQLLRRFKDDWK 19 +IAKVQ G ++DE+FQSLL D C++I +SH+LV +LL+RFKDDWK Sbjct: 74 IIAKVQVGSSEDEVFQSLLQDPVCNSIQLSHDLVYKLLQRFKDDWK 119 >emb|CBI27550.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 65.5 bits (158), Expect = 4e-09 Identities = 34/75 (45%), Positives = 49/75 (65%) Frame = -3 Query: 243 SSRARPVQIVPVQ*SNQETYCVGSPENIDVIAKVQGGRTDDEIFQSLLHDQACSTIPVSH 64 SS P V N E C+ S +I ++++++ G +DDE+F+SL+HD+AC+ IP+S Sbjct: 21 SSLCSPSPFVGTGIGNGEE-CIRSQIDI-IVSRIREGSSDDEVFKSLVHDEACNAIPMSQ 78 Query: 63 ELVCQLLRRFKDDWK 19 LV LL RFKDDWK Sbjct: 79 NLVDVLLHRFKDDWK 93 >ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] Length = 496 Score = 65.5 bits (158), Expect = 4e-09 Identities = 34/75 (45%), Positives = 49/75 (65%) Frame = -3 Query: 243 SSRARPVQIVPVQ*SNQETYCVGSPENIDVIAKVQGGRTDDEIFQSLLHDQACSTIPVSH 64 SS P V N E C+ S +I ++++++ G +DDE+F+SL+HD+AC+ IP+S Sbjct: 21 SSLCSPSPFVGTGIGNGEE-CIRSQIDI-IVSRIREGSSDDEVFKSLVHDEACNAIPMSQ 78 Query: 63 ELVCQLLRRFKDDWK 19 LV LL RFKDDWK Sbjct: 79 NLVDVLLHRFKDDWK 93 >ref|XP_002515001.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546052|gb|EEF47555.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 466 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -3 Query: 165 NIDVI-AKVQGGRTDDEIFQSLLHDQACSTIPVSHELVCQLLRRFKDDWK 19 +IDVI AK++ G + DEI QSL+HD+ C++I +SHELV +LL RFKDDWK Sbjct: 17 DIDVIVAKIRVGSSHDEIVQSLVHDEVCNSIHLSHELVDKLLFRFKDDWK 66