BLASTX nr result
ID: Atractylodes21_contig00018847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018847 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516571.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 ref|XP_002516035.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267... 55 5e-06 >ref|XP_002516571.1| conserved hypothetical protein [Ricinus communis] gi|223544391|gb|EEF45912.1| conserved hypothetical protein [Ricinus communis] Length = 476 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 7/44 (15%) Frame = -2 Query: 112 SNLGVRKLVLYCCCGILAGTAGG-------FIMGPLFLELGVPP 2 +N V +LVLYC CG+LAG GG FIMGPLFLELG+PP Sbjct: 326 TNFKVHQLVLYCSCGVLAGVVGGLLGLGGGFIMGPLFLELGIPP 369 >ref|XP_002516035.1| conserved hypothetical protein [Ricinus communis] gi|223544940|gb|EEF46455.1| conserved hypothetical protein [Ricinus communis] Length = 483 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 7/44 (15%) Frame = -2 Query: 112 SNLGVRKLVLYCCCGILAGTAGG-------FIMGPLFLELGVPP 2 +N V +LVLYC CG+LAG GG FI+GPLFLELGVPP Sbjct: 333 TNWRVHQLVLYCACGVLAGMVGGLLGLGGGFILGPLFLELGVPP 376 >ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267889 [Vitis vinifera] gi|296081886|emb|CBI20891.3| unnamed protein product [Vitis vinifera] Length = 478 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 7/44 (15%) Frame = -2 Query: 112 SNLGVRKLVLYCCCGILAGTAGG-------FIMGPLFLELGVPP 2 +N V +L+LYC CG+LAG GG FI+GPLFLELGVPP Sbjct: 328 TNFRVHQLILYCFCGVLAGIVGGLLGLGGGFILGPLFLELGVPP 371