BLASTX nr result
ID: Atractylodes21_contig00018538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018538 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADX86900.1| auxin response factor [Helianthus annuus] 64 2e-08 >gb|ADX86900.1| auxin response factor [Helianthus annuus] Length = 508 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +2 Query: 5 RRTWPATLIDHKTQIRLYGWPKIRIENHLEIGDTCMFELVKHGEVPAFNFYS 160 +RT PA L Q+RL GW K+ +N+L++GD CMF+LV+ GEVP FNFY+ Sbjct: 193 KRTCPAKLHIMTRQVRLTGWRKLMSKNNLKVGDVCMFKLVEDGEVPVFNFYN 244