BLASTX nr result
ID: Atractylodes21_contig00018484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018484 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001242111.1| uncharacterized protein LOC100787003 [Glycin... 104 9e-21 gb|AAK74028.1| At2g39570/F12L6.23 [Arabidopsis thaliana] gi|2330... 102 4e-20 ref|NP_565908.1| ACT domain-containing protein [Arabidopsis thal... 102 4e-20 ref|XP_002879806.1| ACT domain-containing protein [Arabidopsis l... 100 1e-19 gb|AFK39044.1| unknown [Medicago truncatula] 96 2e-18 >ref|NP_001242111.1| uncharacterized protein LOC100787003 [Glycine max] gi|255636202|gb|ACU18442.1| unknown [Glycine max] Length = 419 Score = 104 bits (259), Expect = 9e-21 Identities = 44/73 (60%), Positives = 57/73 (78%) Frame = +2 Query: 2 DFSTDGKWCYIILWVVARPISLKVDWESLKNRLVSCCPSCLPAFYLDQLSGSSKSPPLYL 181 D STDG+WCYI+ WV+A P SL VDWESLK RL+S CPSCL +++ +Q S S PP+YL Sbjct: 52 DISTDGRWCYIVYWVLAHPASLNVDWESLKTRLLSACPSCLLSYHFNQHSTSPSPPPIYL 111 Query: 182 LKVFSLDRKGLIH 220 KV+ +D+KGL+H Sbjct: 112 SKVWCVDQKGLLH 124 >gb|AAK74028.1| At2g39570/F12L6.23 [Arabidopsis thaliana] gi|23308377|gb|AAN18158.1| At2g39570/F12L6.23 [Arabidopsis thaliana] Length = 411 Score = 102 bits (253), Expect = 4e-20 Identities = 46/73 (63%), Positives = 53/73 (72%) Frame = +2 Query: 2 DFSTDGKWCYIILWVVARPISLKVDWESLKNRLVSCCPSCLPAFYLDQLSGSSKSPPLYL 181 DFSTDG+WCYI+ WV S K+DW+SLKNRL+S CPSCL +FY S SK P LYL Sbjct: 52 DFSTDGRWCYIVFWVTPDISSPKIDWDSLKNRLLSACPSCLGSFYFCLQSNVSKPPSLYL 111 Query: 182 LKVFSLDRKGLIH 220 LK F DRKGL+H Sbjct: 112 LKFFCRDRKGLLH 124 >ref|NP_565908.1| ACT domain-containing protein [Arabidopsis thaliana] gi|3355486|gb|AAC27848.1| expressed protein [Arabidopsis thaliana] gi|330254601|gb|AEC09695.1| ACT domain-containing protein [Arabidopsis thaliana] gi|347949474|gb|AEP31950.1| ACT domain-containing protein [Arabidopsis thaliana] Length = 411 Score = 102 bits (253), Expect = 4e-20 Identities = 46/73 (63%), Positives = 53/73 (72%) Frame = +2 Query: 2 DFSTDGKWCYIILWVVARPISLKVDWESLKNRLVSCCPSCLPAFYLDQLSGSSKSPPLYL 181 DFSTDG+WCYI+ WV S K+DW+SLKNRL+S CPSCL +FY S SK P LYL Sbjct: 52 DFSTDGRWCYIVFWVTPDISSPKIDWDSLKNRLLSACPSCLGSFYFCLQSNVSKPPSLYL 111 Query: 182 LKVFSLDRKGLIH 220 LK F DRKGL+H Sbjct: 112 LKFFCRDRKGLLH 124 >ref|XP_002879806.1| ACT domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325645|gb|EFH56065.1| ACT domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 100 bits (250), Expect = 1e-19 Identities = 45/73 (61%), Positives = 53/73 (72%) Frame = +2 Query: 2 DFSTDGKWCYIILWVVARPISLKVDWESLKNRLVSCCPSCLPAFYLDQLSGSSKSPPLYL 181 DFSTDG+WCYI+ WV S ++DW+SLKNRL+S CPSCL +FY S SK P LYL Sbjct: 52 DFSTDGRWCYIVFWVTPDISSPRIDWDSLKNRLLSACPSCLGSFYFCLQSNVSKPPSLYL 111 Query: 182 LKVFSLDRKGLIH 220 LK F DRKGL+H Sbjct: 112 LKFFCRDRKGLLH 124 >gb|AFK39044.1| unknown [Medicago truncatula] Length = 418 Score = 96.3 bits (238), Expect = 2e-18 Identities = 41/73 (56%), Positives = 57/73 (78%) Frame = +2 Query: 2 DFSTDGKWCYIILWVVARPISLKVDWESLKNRLVSCCPSCLPAFYLDQLSGSSKSPPLYL 181 D STDG+WC+I+ WV+ P SLK+DWE+LK RL+S CPSCL ++ +Q + S PP+YL Sbjct: 52 DISTDGRWCFIVFWVIPHPASLKIDWENLKTRLLSPCPSCLFSYNFNQRNPS--PPPIYL 109 Query: 182 LKVFSLDRKGLIH 220 LKV+ +D+KGL+H Sbjct: 110 LKVWIIDQKGLLH 122