BLASTX nr result
ID: Atractylodes21_contig00018372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018372 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23503.3| unnamed protein product [Vitis vinifera] 99 5e-19 ref|YP_173426.1| hypothetical protein NitaMp085 [Nicotiana tabac... 91 1e-17 >emb|CBI23503.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 98.6 bits (244), Expect = 5e-19 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -1 Query: 354 WQQQKGRGPCSCCARPPLSQWGSRFGIYYKRENPLQITTPLLGS 223 WQQQKGRGPCSCCARP LSQWGSRFGIYYKRENPLQITTPLLGS Sbjct: 201 WQQQKGRGPCSCCARPLLSQWGSRFGIYYKRENPLQITTPLLGS 244 >ref|YP_173426.1| hypothetical protein NitaMp085 [Nicotiana tabacum] gi|56806590|dbj|BAD83491.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 162 Score = 90.5 bits (223), Expect(2) = 1e-17 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -3 Query: 289 QQVRHLLQKRESTSDNHASARQRVEWPRADLIGYIIQVESRVTGTAV 149 QQVRHLLQKRESTSDNH SARQRVEWPRADL GYIIQVESRVTG AV Sbjct: 116 QQVRHLLQKRESTSDNHVSARQRVEWPRADLFGYIIQVESRVTGKAV 162 Score = 24.3 bits (51), Expect(2) = 1e-17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 353 GNNRKEGVH 327 GNNRKEGVH Sbjct: 94 GNNRKEGVH 102