BLASTX nr result
ID: Atractylodes21_contig00018349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018349 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588352.1| NADH dehydrogenase subunit [Medicago truncat... 106 6e-26 >ref|XP_003588352.1| NADH dehydrogenase subunit [Medicago truncatula] gi|355477400|gb|AES58603.1| NADH dehydrogenase subunit [Medicago truncatula] Length = 1094 Score = 106 bits (264), Expect(3) = 6e-26 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -2 Query: 201 SMLHESAAFSVVLSHSCPPRRATRSVVLSHKISTPPACWPGESKFSSGQLSTQSSAK 31 +ML+ESAAFSVV SHSCPPRRATRSVVLSHKISTPPA WPGESK SSGQLSTQSSAK Sbjct: 193 AMLNESAAFSVVFSHSCPPRRATRSVVLSHKISTPPASWPGESKLSSGQLSTQSSAK 249 Score = 32.7 bits (73), Expect(3) = 6e-26 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -1 Query: 289 QIAANLPNRARAGLRA 242 +IAANLPNRARAGLRA Sbjct: 178 RIAANLPNRARAGLRA 193 Score = 23.5 bits (49), Expect(3) = 6e-26 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 32 KNTVESRNAR 3 KNTVESRNAR Sbjct: 249 KNTVESRNAR 258