BLASTX nr result
ID: Atractylodes21_contig00018230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018230 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA27046.1| TO76-23 [Taraxacum officinale] 56 3e-06 >gb|ABA27046.1| TO76-23 [Taraxacum officinale] Length = 103 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 53 LMSKKAFSKMAQSTYAVSSLASQGIVDIEYRRPS 154 +MSKKAF KMAQSTY+ SSL SQGIVDIEYRR S Sbjct: 5 IMSKKAFQKMAQSTYSESSLLSQGIVDIEYRRVS 38