BLASTX nr result
ID: Atractylodes21_contig00018229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018229 (168 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE68427.1| hypothetical protein OsJ_26794 [Oryza sativa Japo... 61 1e-07 >gb|EEE68427.1| hypothetical protein OsJ_26794 [Oryza sativa Japonica Group] Length = 368 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 64 QADAVTLDAIDWWSTYGSETPELAEVAKKVLSQPI 168 QADA +++ I+WW +YGSETPELAEVAK+VLSQPI Sbjct: 269 QADAASMEPIEWWCSYGSETPELAEVAKRVLSQPI 303