BLASTX nr result
ID: Atractylodes21_contig00018022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00018022 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521161.1| photosystem I reaction center subunit IV A, ... 61 1e-07 ref|XP_003625462.1| Photosystem I reaction center subunit IV A [... 58 7e-07 gb|ACJ84185.1| unknown [Medicago truncatula] gi|388516619|gb|AFK... 58 9e-07 >ref|XP_002521161.1| photosystem I reaction center subunit IV A, chloroplast precursor [Ricinus communis] gi|223539730|gb|EEF41312.1| photosystem I reaction center subunit IV A, chloroplast precursor [Ricinus communis] Length = 141 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/54 (62%), Positives = 42/54 (77%), Gaps = 3/54 (5%) Frame = +1 Query: 46 MASCSMASAATGFVVTPNLTSNTN-TVKCNMVMLPL--HNTRGSRLVVRAAEEA 198 MASCSMASAA+GF++TPN+ +NTN + + NMV P +N SRLVVRAAEEA Sbjct: 1 MASCSMASAASGFLLTPNVPANTNSSSRSNMVYFPSKNNNINNSRLVVRAAEEA 54 >ref|XP_003625462.1| Photosystem I reaction center subunit IV A [Medicago truncatula] gi|355500477|gb|AES81680.1| Photosystem I reaction center subunit IV A [Medicago truncatula] gi|388502410|gb|AFK39271.1| unknown [Medicago truncatula] Length = 138 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 5/56 (8%) Frame = +1 Query: 46 MASCSMASAATGFVVTPN-LTSNTNT----VKCNMVMLPLHNTRGSRLVVRAAEEA 198 MASC+MASAA+GFV++PN ++ NTNT + NMVM P SRLVVRA+EEA Sbjct: 1 MASCNMASAASGFVLSPNNVSGNTNTNLLVSRMNMVMYPTTRNTNSRLVVRASEEA 56 >gb|ACJ84185.1| unknown [Medicago truncatula] gi|388516619|gb|AFK46371.1| unknown [Medicago truncatula] Length = 138 Score = 57.8 bits (138), Expect = 9e-07 Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 5/56 (8%) Frame = +1 Query: 46 MASCSMASAATGFVVTPNLTS-NTNT----VKCNMVMLPLHNTRGSRLVVRAAEEA 198 MASC+MASAA+GFV++PN S NTNT + NMVM P SRLVVRA+EEA Sbjct: 1 MASCNMASAASGFVLSPNNVSCNTNTNLLVSRMNMVMYPTTRNTNSRLVVRASEEA 56