BLASTX nr result
ID: Atractylodes21_contig00017946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00017946 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269795.1| PREDICTED: mitochondrial import receptor sub... 61 1e-07 sp|P92792.1|TOM20_SOLTU RecName: Full=Mitochondrial import recep... 60 2e-07 ref|XP_003551330.1| PREDICTED: mitochondrial import receptor sub... 60 2e-07 ref|NP_001241027.1| uncharacterized protein LOC100819858 [Glycin... 60 2e-07 ref|NP_001235550.1| uncharacterized protein LOC100499753 [Glycin... 60 2e-07 >ref|XP_002269795.1| PREDICTED: mitochondrial import receptor subunit TOM20 [Vitis vinifera] gi|296082346|emb|CBI21351.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 229 YDIFGWVILAVTIVAWVGFAKSNVPSPPPR 140 YDIFGW+ILAV IVAWVGFAKS+VP PPPR Sbjct: 172 YDIFGWIILAVGIVAWVGFAKSHVPPPPPR 201 >sp|P92792.1|TOM20_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM20; AltName: Full=Translocase of outer membrane 20 kDa subunit gi|1524370|emb|CAA63223.1| TOM20 [Solanum tuberosum] Length = 204 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 229 YDIFGWVILAVTIVAWVGFAKSNVPSPPP 143 YDIFGWVILAV IVAWVGFAKSN+P PPP Sbjct: 172 YDIFGWVILAVGIVAWVGFAKSNMPPPPP 200 >ref|XP_003551330.1| PREDICTED: mitochondrial import receptor subunit TOM20-like [Glycine max] Length = 201 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 229 YDIFGWVILAVTIVAWVGFAKSNVPSPPPR 140 YDIFGW+ILAV IVAWVG AKSN+P PPPR Sbjct: 172 YDIFGWIILAVGIVAWVGMAKSNIPPPPPR 201 >ref|NP_001241027.1| uncharacterized protein LOC100819858 [Glycine max] gi|255647408|gb|ACU24169.1| unknown [Glycine max] Length = 210 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 229 YDIFGWVILAVTIVAWVGFAKSNVPSPPP 143 YDIFGW+ILAV IVAWVGFAKSN+P PPP Sbjct: 178 YDIFGWIILAVGIVAWVGFAKSNLPPPPP 206 >ref|NP_001235550.1| uncharacterized protein LOC100499753 [Glycine max] gi|255626295|gb|ACU13492.1| unknown [Glycine max] Length = 209 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 229 YDIFGWVILAVTIVAWVGFAKSNVPSPPP 143 YDIFGW+ILAV IVAWVGFAKSN+P PPP Sbjct: 177 YDIFGWIILAVGIVAWVGFAKSNLPPPPP 205