BLASTX nr result
ID: Atractylodes21_contig00017701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00017701 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268646.1| PREDICTED: 50S ribosomal protein L15 [Vitis ... 79 2e-22 ref|XP_002298658.1| predicted protein [Populus trichocarpa] gi|2... 79 6e-22 ref|XP_002329967.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-21 ref|XP_002522195.1| 60S ribosomal protein L10, mitochondrial, pu... 75 7e-20 ref|XP_002455499.1| hypothetical protein SORBIDRAFT_03g012270 [S... 80 9e-20 >ref|XP_002268646.1| PREDICTED: 50S ribosomal protein L15 [Vitis vinifera] gi|296085970|emb|CBI31411.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 79.3 bits (194), Expect(2) = 2e-22 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 3 AVEAAGGTVRRVYYNKLGFRALLKPEWFEKKGRLLPKAA 119 AVEAAGG+VRRVYYNKLGF+ALLKPEWFEKKGRLLPKAA Sbjct: 207 AVEAAGGSVRRVYYNKLGFQALLKPEWFEKKGRLLPKAA 245 Score = 51.6 bits (122), Expect(2) = 2e-22 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 157 KVDSIGRLPAPTKPIPFGDEEKQAAMSPS 243 KVDSIGRLPAPTKPIPF EEK+AA +PS Sbjct: 254 KVDSIGRLPAPTKPIPFLPEEKEAAFTPS 282 >ref|XP_002298658.1| predicted protein [Populus trichocarpa] gi|222845916|gb|EEE83463.1| predicted protein [Populus trichocarpa] Length = 227 Score = 79.0 bits (193), Expect(2) = 6e-22 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 3 AVEAAGGTVRRVYYNKLGFRALLKPEWFEKKGRLLPKAA 119 AVEAAGG+VRRV+YNKLGFRALLKPEWFEKKGRLLPKAA Sbjct: 153 AVEAAGGSVRRVHYNKLGFRALLKPEWFEKKGRLLPKAA 191 Score = 50.1 bits (118), Expect(2) = 6e-22 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 157 KVDSIGRLPAPTKPIPFGDEEKQAAMSP 240 KVDSIGRLPAPTKPIPF EEK+AA +P Sbjct: 200 KVDSIGRLPAPTKPIPFYTEEKEAASAP 227 >ref|XP_002329967.1| predicted protein [Populus trichocarpa] gi|222871989|gb|EEF09120.1| predicted protein [Populus trichocarpa] Length = 224 Score = 75.1 bits (183), Expect(2) = 6e-21 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVEAAGGTVRRVYYNKLGFRALLKPEWFEKKGRLLPKAA 119 AVEAAGG+VRRV+YN+LG RALLKPEWFEKKGRLLPKAA Sbjct: 149 AVEAAGGSVRRVHYNQLGLRALLKPEWFEKKGRLLPKAA 187 Score = 50.4 bits (119), Expect(2) = 6e-21 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 157 KVDSIGRLPAPTKPIPFGDEEKQAAMSPS 243 KVDSIGRLPAPTKPIPF EEK+AA +P+ Sbjct: 196 KVDSIGRLPAPTKPIPFYTEEKEAASTPA 224 >ref|XP_002522195.1| 60S ribosomal protein L10, mitochondrial, putative [Ricinus communis] gi|223538566|gb|EEF40170.1| 60S ribosomal protein L10, mitochondrial, putative [Ricinus communis] Length = 275 Score = 74.7 bits (182), Expect(2) = 7e-20 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AVEAAGGTVRRVYYNKLGFRALLKPEWFEKKGRLLPKAA 119 AVEAAGG+VRRV+YNKLG RALLKPEWFEKKGRLLPK A Sbjct: 200 AVEAAGGSVRRVHYNKLGLRALLKPEWFEKKGRLLPKPA 238 Score = 47.4 bits (111), Expect(2) = 7e-20 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +1 Query: 157 KVDSIGRLPAPTKPIPFGDEEKQAAMSPS 243 KVDSIGRLPAPTKPIPF E+K+A +P+ Sbjct: 247 KVDSIGRLPAPTKPIPFYAEDKEAVSTPA 275 >ref|XP_002455499.1| hypothetical protein SORBIDRAFT_03g012270 [Sorghum bicolor] gi|241927474|gb|EES00619.1| hypothetical protein SORBIDRAFT_03g012270 [Sorghum bicolor] Length = 292 Score = 79.7 bits (195), Expect(2) = 9e-20 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVEAAGGTVRRVYYNKLGFRALLKPEWFEKKGRLLPKAA 119 AVEAAGGTVR VYYNKLGFRALLKPEWFEKKGRLLPKAA Sbjct: 209 AVEAAGGTVRLVYYNKLGFRALLKPEWFEKKGRLLPKAA 247 Score = 42.0 bits (97), Expect(2) = 9e-20 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +1 Query: 157 KVDSIGRLPAPTKPIPFGDEEKQAA 231 KVDSIGRLPAPTKP+PF EE + A Sbjct: 256 KVDSIGRLPAPTKPLPFTPEELEFA 280