BLASTX nr result
ID: Atractylodes21_contig00017632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00017632 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD79348.1| ferredoxin precursor [Digitalis lanata] 69 4e-10 ref|XP_003550595.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] 68 7e-10 ref|XP_003542378.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] 68 7e-10 ref|XP_003532620.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] 68 7e-10 ref|XP_002516221.1| adrenodoxin, putative [Ricinus communis] gi|... 68 7e-10 >emb|CAD79348.1| ferredoxin precursor [Digitalis lanata] Length = 181 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 309 CQVIAKPELDGLRLALPAATRNFAVDGYKPKPH 211 CQ+IAKPELDGLRLALP+ATRNFAVDG+KPKPH Sbjct: 149 CQIIAKPELDGLRLALPSATRNFAVDGHKPKPH 181 >ref|XP_003550595.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Length = 198 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 309 CQVIAKPELDGLRLALPAATRNFAVDGYKPKPH 211 CQVIAKPELDG+RLA+PAATRNFAVDGY PKPH Sbjct: 166 CQVIAKPELDGIRLAIPAATRNFAVDGYVPKPH 198 >ref|XP_003542378.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Length = 199 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 309 CQVIAKPELDGLRLALPAATRNFAVDGYKPKPH 211 CQVIAKPELDG+RLA+PAATRNFAVDGY PKPH Sbjct: 167 CQVIAKPELDGIRLAIPAATRNFAVDGYVPKPH 199 >ref|XP_003532620.1| PREDICTED: 2Fe-2S ferredoxin-like [Glycine max] Length = 133 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 309 CQVIAKPELDGLRLALPAATRNFAVDGYKPKPH 211 CQVIAKPELDG+RLA+PAATRNFAVDGY PKPH Sbjct: 101 CQVIAKPELDGIRLAIPAATRNFAVDGYVPKPH 133 >ref|XP_002516221.1| adrenodoxin, putative [Ricinus communis] gi|223544707|gb|EEF46223.1| adrenodoxin, putative [Ricinus communis] Length = 199 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 309 CQVIAKPELDGLRLALPAATRNFAVDGYKPKPH 211 CQVIAKPELDG+RLA+PAATRNFAVDGY PKPH Sbjct: 167 CQVIAKPELDGIRLAIPAATRNFAVDGYVPKPH 199