BLASTX nr result
ID: Atractylodes21_contig00017405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00017405 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328561.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 gb|ABK27119.1| unknown [Picea sitchensis] 74 1e-11 ref|XP_002517198.1| peroxisomal membrane protein pmp34, putative... 73 2e-11 ref|XP_002512372.1| peroxisomal membrane protein pmp34, putative... 73 3e-11 emb|CBI36764.3| unnamed protein product [Vitis vinifera] 72 4e-11 >ref|XP_002328561.1| predicted protein [Populus trichocarpa] gi|222838276|gb|EEE76641.1| predicted protein [Populus trichocarpa] Length = 317 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 207 PLDTASSRMQTSAFGRSKGLWEMLTEGSWIEAFDGLGIS 91 PLDTASSRMQTSAFG+SKGLWE LTEGSW +AFDGLGIS Sbjct: 126 PLDTASSRMQTSAFGKSKGLWETLTEGSWSDAFDGLGIS 164 >gb|ABK27119.1| unknown [Picea sitchensis] Length = 327 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 207 PLDTASSRMQTSAFGRSKGLWEMLTEGSWIEAFDGLGIS 91 PLDTAS+RMQTSAFG+SKGLW+ LTEGSW EAFDGLG+S Sbjct: 126 PLDTASARMQTSAFGKSKGLWQTLTEGSWKEAFDGLGVS 164 >ref|XP_002517198.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] gi|223543833|gb|EEF45361.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] Length = 427 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 207 PLDTASSRMQTSAFGRSKGLWEMLTEGSWIEAFDGLGIS 91 PLDTA+SRMQTSAFG+SKGLWE L+EG+W EAFDGLGIS Sbjct: 233 PLDTAASRMQTSAFGKSKGLWETLSEGTWSEAFDGLGIS 271 >ref|XP_002512372.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] gi|223548333|gb|EEF49824.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] Length = 318 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 207 PLDTASSRMQTSAFGRSKGLWEMLTEGSWIEAFDGLGIS 91 PLDTASSRMQTSAFG+SKGLW+ LTEG+W +AFDGLGIS Sbjct: 126 PLDTASSRMQTSAFGKSKGLWQTLTEGNWGDAFDGLGIS 164 >emb|CBI36764.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 207 PLDTASSRMQTSAFGRSKGLWEMLTEGSWIEAFDGLGIS 91 PLDTASSRMQTSAFG+SKGLW+ LT G+W EAFDGLGIS Sbjct: 126 PLDTASSRMQTSAFGKSKGLWQTLTAGTWSEAFDGLGIS 164