BLASTX nr result
ID: Atractylodes21_contig00016325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00016325 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus... 72 6e-11 emb|CBI14940.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002277262.1| PREDICTED: uncharacterized protein LOC100255... 71 1e-10 gb|AFW61421.1| hypothetical protein ZEAMMB73_090575 [Zea mays] 70 1e-10 ref|NP_001168135.1| uncharacterized protein LOC100381882 [Zea ma... 70 1e-10 >ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223540999|gb|EEF42557.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 248 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 311 PLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALRK 207 PLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNAL+K Sbjct: 213 PLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKK 247 >emb|CBI14940.3| unnamed protein product [Vitis vinifera] Length = 270 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 311 PLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALRK 207 PLYSP+IKEIKVLDKKKVRRAKLYYLRDKMNALRK Sbjct: 236 PLYSPSIKEIKVLDKKKVRRAKLYYLRDKMNALRK 270 >ref|XP_002277262.1| PREDICTED: uncharacterized protein LOC100255272 [Vitis vinifera] Length = 243 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 311 PLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALRK 207 PLYSP+IKEIKVLDKKKVRRAKLYYLRDKMNALRK Sbjct: 209 PLYSPSIKEIKVLDKKKVRRAKLYYLRDKMNALRK 243 >gb|AFW61421.1| hypothetical protein ZEAMMB73_090575 [Zea mays] Length = 81 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 311 PLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALRK 207 PLYSPNIKEIKVLD+KKVRRAKLYYLRD+MNALRK Sbjct: 47 PLYSPNIKEIKVLDRKKVRRAKLYYLRDRMNALRK 81 >ref|NP_001168135.1| uncharacterized protein LOC100381882 [Zea mays] gi|223946231|gb|ACN27199.1| unknown [Zea mays] gi|413921488|gb|AFW61420.1| hypothetical protein ZEAMMB73_090575 [Zea mays] Length = 238 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 311 PLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALRK 207 PLYSPNIKEIKVLD+KKVRRAKLYYLRD+MNALRK Sbjct: 204 PLYSPNIKEIKVLDRKKVRRAKLYYLRDRMNALRK 238