BLASTX nr result
ID: Atractylodes21_contig00016084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00016084 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531353.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002531353.1| conserved hypothetical protein [Ricinus communis] gi|223529051|gb|EEF31037.1| conserved hypothetical protein [Ricinus communis] Length = 85 Score = 55.1 bits (131), Expect = 6e-06 Identities = 35/75 (46%), Positives = 42/75 (56%), Gaps = 5/75 (6%) Frame = +2 Query: 11 LSTKMSRRVSFSPDVDGMPSPPLLHFKHGGDTAEPMIR-----IWTFRPPKNSGFSAIRF 175 +S K S+RVSFSPDV P + KHGG T + R I+TFR P++S FS R Sbjct: 1 MSGKSSKRVSFSPDVH---EKPTIFLKHGGGTRAGVNRKRVAGIFTFRLPRSSKFSPGRL 57 Query: 176 LGRIKAKFARALGFV 220 L R AK R L FV Sbjct: 58 LSRFSAKVVRVLRFV 72