BLASTX nr result
ID: Atractylodes21_contig00015993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015993 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 82 5e-14 ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 gb|ADM76128.1| auxin efflux carrier-like protein [Picea sitchensis] 80 2e-13 gb|ADM76125.1| auxin efflux carrier-like protein [Picea sitchens... 80 2e-13 gb|ADM76107.1| auxin efflux carrier-like protein [Picea sitchensis] 80 2e-13 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = +3 Query: 66 LPIVGIMVIKAAGSLGLLPSDPLFNFVLLIQYTVPPAMNIGTMTQLF 206 LP +GI ++KAAGSLG LPSDPL++FVL++QYT+PPAMNIGTMTQLF Sbjct: 326 LPAIGIWLVKAAGSLGFLPSDPLYHFVLMVQYTLPPAMNIGTMTQLF 372 >ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|222855870|gb|EEE93417.1| predicted protein [Populus trichocarpa] Length = 397 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = +3 Query: 66 LPIVGIMVIKAAGSLGLLPSDPLFNFVLLIQYTVPPAMNIGTMTQLF 206 LP +G+ V+KAAG LG LPSDPLF++VL+IQYT+PPAMNIGTMTQLF Sbjct: 317 LPAIGMWVVKAAGHLGFLPSDPLFHYVLMIQYTLPPAMNIGTMTQLF 363 >gb|ADM76128.1| auxin efflux carrier-like protein [Picea sitchensis] Length = 227 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 66 LPIVGIMVIKAAGSLGLLPSDPLFNFVLLIQYTVPPAMNIGTMTQLF 206 LP++GI V+K A +LGLLP+DPL++FVL+IQYTVPPAMNIGTM QLF Sbjct: 161 LPVIGIFVVKGASNLGLLPADPLYHFVLMIQYTVPPAMNIGTMAQLF 207 >gb|ADM76125.1| auxin efflux carrier-like protein [Picea sitchensis] gi|306014145|gb|ADM76126.1| auxin efflux carrier-like protein [Picea sitchensis] gi|306014147|gb|ADM76127.1| auxin efflux carrier-like protein [Picea sitchensis] Length = 227 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 66 LPIVGIMVIKAAGSLGLLPSDPLFNFVLLIQYTVPPAMNIGTMTQLF 206 LP++GI V+K A +LGLLP+DPL++FVL+IQYTVPPAMNIGTM QLF Sbjct: 161 LPVIGIFVVKGASNLGLLPADPLYHFVLMIQYTVPPAMNIGTMAQLF 207 >gb|ADM76107.1| auxin efflux carrier-like protein [Picea sitchensis] Length = 227 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 66 LPIVGIMVIKAAGSLGLLPSDPLFNFVLLIQYTVPPAMNIGTMTQLF 206 LP++GI V+K A +LGLLP+DPL++FVL+IQYTVPPAMNIGTM QLF Sbjct: 161 LPVIGIFVVKGASNLGLLPADPLYHFVLMIQYTVPPAMNIGTMAQLF 207