BLASTX nr result
ID: Atractylodes21_contig00015776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015776 (624 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 110 2e-22 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 110 2e-22 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 105 9e-21 gb|ABK21382.1| unknown [Picea sitchensis] 102 6e-20 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 102 7e-20 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|356513233|ref|XP_003525318.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 2 [Glycine max] Length = 72 Score = 110 bits (276), Expect = 2e-22 Identities = 50/72 (69%), Positives = 63/72 (87%) Frame = +2 Query: 113 MSSKLVLKPKGKSTKASKRSDDNSPSKLLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSE 292 M+S++ LK KGKS+K SK ++D S S+ LKEW+TW M+KAKV+THYGFIPL+IIIGMNS+ Sbjct: 1 MASRVSLKAKGKSSKGSKAAEDRSASECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSD 60 Query: 293 PKPSISQLLSPV 328 PKP +SQLLSPV Sbjct: 61 PKPPLSQLLSPV 72 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|356524002|ref|XP_003530622.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 2 [Glycine max] Length = 72 Score = 110 bits (275), Expect = 2e-22 Identities = 49/72 (68%), Positives = 63/72 (87%) Frame = +2 Query: 113 MSSKLVLKPKGKSTKASKRSDDNSPSKLLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSE 292 M+S++ LK KGKS+K SK ++D S S+ LKEW+TW M+KAKV+THYGFIPL+I+IGMNS+ Sbjct: 1 MASRVSLKAKGKSSKGSKAAEDRSASECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSD 60 Query: 293 PKPSISQLLSPV 328 PKP +SQLLSPV Sbjct: 61 PKPPLSQLLSPV 72 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 105 bits (261), Expect = 9e-21 Identities = 50/73 (68%), Positives = 63/73 (86%), Gaps = 1/73 (1%) Frame = +2 Query: 113 MSSKLVLKPKGKSTKAS-KRSDDNSPSKLLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNS 289 M+SK+ L+ KGKS+K+S K S++ S ++ KEW+TW +KKAKVVTHYGFIPL+IIIGMNS Sbjct: 1 MASKVSLRSKGKSSKSSSKSSEEKSATQAFKEWTTWAVKKAKVVTHYGFIPLVIIIGMNS 60 Query: 290 EPKPSISQLLSPV 328 EPKP +SQLLSPV Sbjct: 61 EPKPQLSQLLSPV 73 >gb|ABK21382.1| unknown [Picea sitchensis] Length = 72 Score = 102 bits (254), Expect = 6e-20 Identities = 48/72 (66%), Positives = 57/72 (79%) Frame = +2 Query: 113 MSSKLVLKPKGKSTKASKRSDDNSPSKLLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSE 292 M+S+ K KGK K SK + S +K +KEW+TW MK+AK VTHYGFIPL+IIIGMNSE Sbjct: 1 MASRANSKGKGKMGKGSKHGESRSATKAVKEWTTWVMKRAKTVTHYGFIPLVIIIGMNSE 60 Query: 293 PKPSISQLLSPV 328 PKPSI+QLLSPV Sbjct: 61 PKPSIAQLLSPV 72 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 102 bits (253), Expect = 7e-20 Identities = 48/72 (66%), Positives = 59/72 (81%), Gaps = 5/72 (6%) Frame = +2 Query: 128 VLKPKGKSTKASKRSDDNSPS-----KLLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSE 292 +LKPKGK+TK + +D++ + K +KEW TWT KKAKV+THYGFIPL+IIIGMNSE Sbjct: 1 MLKPKGKNTKKAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSE 60 Query: 293 PKPSISQLLSPV 328 PKPS+SQLLSPV Sbjct: 61 PKPSLSQLLSPV 72